The protein encoded by this gene belongs to the poly(A) polymerase family. It is required for the addition of adenosine residues for the creation of the 3'-poly(A) tail of mRNAs. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] See more...

Aliases for PAPOLA Gene

Aliases for PAPOLA Gene

  • Poly(A) Polymerase Alpha 2 3 4 5
  • PAP 2 3 4
  • Polynucleotide Adenylyltransferase Alpha 3 4
  • EC 2.7.7.19 4 50
  • PAP-Alpha 3 4
  • EC 2.7.7 50
  • PAPOLA 5

External Ids for PAPOLA Gene

Previous GeneCards Identifiers for PAPOLA Gene

  • GC14P094479
  • GC14P090785
  • GC14P094958
  • GC14P096038
  • GC14P096969
  • GC14P077153

Summaries for PAPOLA Gene

Entrez Gene Summary for PAPOLA Gene

  • The protein encoded by this gene belongs to the poly(A) polymerase family. It is required for the addition of adenosine residues for the creation of the 3'-poly(A) tail of mRNAs. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

GeneCards Summary for PAPOLA Gene

PAPOLA (Poly(A) Polymerase Alpha) is a Protein Coding gene. Diseases associated with PAPOLA include 46,Xx Sex Reversal 3 and Developmental And Epileptic Encephalopathy 1. Among its related pathways are Processing of Capped Intronless Pre-mRNA and Tat-mediated elongation of the HIV-1 transcript. Gene Ontology (GO) annotations related to this gene include RNA binding and manganese ion binding. An important paralog of this gene is PAPOLB.

UniProtKB/Swiss-Prot Summary for PAPOLA Gene

  • Polymerase that creates the 3'-poly(A) tail of mRNA's. Also required for the endoribonucleolytic cleavage reaction at some polyadenylation sites. May acquire specificity through interaction with a cleavage and polyadenylation specificity factor (CPSF) at its C-terminus.

Gene Wiki entry for PAPOLA Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PAPOLA Gene

Genomics for PAPOLA Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for PAPOLA Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PAPOLA on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PAPOLA

Top Transcription factor binding sites by QIAGEN in the PAPOLA gene promoter:
  • AhR
  • AML1a
  • AP-1
  • Arnt
  • c-Fos
  • c-Jun
  • Egr-2
  • FOXO4
  • MRF-2
  • Sox5

Genomic Locations for PAPOLA Gene

Latest Assembly
chr14:96,501,433-96,567,116
(GRCh38/hg38)
Size:
65,684 bases
Orientation:
Plus strand

Previous Assembly
chr14:96,968,713-97,033,453
(GRCh37/hg19 by Entrez Gene)
Size:
64,741 bases
Orientation:
Plus strand

chr14:96,967,770-97,033,448
(GRCh37/hg19 by Ensembl)
Size:
65,679 bases
Orientation:
Plus strand

Genomic View for PAPOLA Gene

Genes around PAPOLA on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PAPOLA Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PAPOLA Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PAPOLA Gene

Proteins for PAPOLA Gene

  • Protein details for PAPOLA Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P51003-PAPOA_HUMAN
    Recommended name:
    Poly(A) polymerase alpha
    Protein Accession:
    P51003
    Secondary Accessions:
    • Q86SX4
    • Q86TV0
    • Q8IYF5
    • Q9BVU2

    Protein attributes for PAPOLA Gene

    Size:
    745 amino acids
    Molecular mass:
    82843 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Cofactor:
    Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
    Quaternary structure:
    • Monomer. Found in a complex with CPSF1, FIP1L1 and PAPOLA. Interacts with AHCYL1 and FIP1L1; the interaction with AHCYL1 seems to increase interaction with FIP1L1 (PubMed:19224921). Interacts with NUDT21; the interaction is diminished by acetylation. Interacts with KPNB1; the interaction promotes PAP nuclear import and is inhibited by acetylation of PAP (By similarity).

    Alternative splice isoforms for PAPOLA Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PAPOLA Gene

Selected DME Specific Peptides for PAPOLA Gene

P51003:
  • KFFLVFS
  • SLNGCRVTD
  • QEEVKDLR
  • QSVIENV
  • FFQKYKHYIVLLASA
  • SPISLAAPK
  • PNFFQKY
  • PFGVFEEEEELQRRIL
  • NSMSVPS
  • LRAIKLWA
  • SESKNLP
  • LPQSVIENVGGKIFTFG
  • IYSNILGFLGGVSWA
  • NLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNV
  • EESPKKTKTEEDE
  • WEWPNPVLLK
  • ENSENLSVDLTYDIQSFTDTV
  • CQLYPNA
  • KAEWSKLF
  • SSTDLSDI
  • WAMLVAR
  • EEFRTMWVIGL
  • DLTYDIQSFTDTVYRQA
  • LEWVGLVESKIR

Post-translational modifications for PAPOLA Gene

  • Polysumoylated. Varying sumolyation depending on tissue- and cell-type. Highly sumoylated in bladder and NIH 3T3 cells. Sumoylation is required for nuclear localization and enhances PAP stability. Desumoylated by SENP1. Inhibits polymerase activity (By similarity).
  • Hyperphosphorylation on multiple CDK2 consensus and non-consensus sites in the C-terminal Ser/Thr-rich region represses PAP activity in late M-phase. Phosphorylation/dephosphorylation may regulate the interaction between PAP and CPSF (By similarity).
  • Acetylated in the C-terminus. Acetylation decreases interaction with NUDT21 and KPNB1, and inhibits nuclear localization through inhibiting binding to the importin alpha/beta complex (By similarity).
  • Ubiquitination at Lys67 and Lys360
  • Modification sites at PhosphoSitePlus

Antibodies for research

  • Abcam antibodies for PAPOLA
  • Boster Bio Antibodies for PAPOLA

Domains & Families for PAPOLA Gene

Gene Families for PAPOLA Gene

Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for PAPOLA Gene

InterPro:
Blocks:
  • DNA polymerase, beta-like region
  • Poly(A) polymerase, central region

Suggested Antigen Peptide Sequences for PAPOLA Gene

GenScript: Design optimal peptide antigens:
  • Polynucleotide adenylyltransferase alpha (PAPOA_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P51003

UniProtKB/Swiss-Prot:

PAPOA_HUMAN :
  • Belongs to the poly(A) polymerase family.
Family:
  • Belongs to the poly(A) polymerase family.
genes like me logo Genes that share domains with PAPOLA: view

Function for PAPOLA Gene

Molecular function for PAPOLA Gene

UniProtKB/Swiss-Prot Function:
Polymerase that creates the 3'-poly(A) tail of mRNA's. Also required for the endoribonucleolytic cleavage reaction at some polyadenylation sites. May acquire specificity through interaction with a cleavage and polyadenylation specificity factor (CPSF) at its C-terminus.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide; Xref=Rhea:RHEA:11332, Rhea:RHEA-COMP:11128, Rhea:RHEA-COMP:14647, ChEBI:CHEBI:30616, ChEBI:CHEBI:33019, ChEBI:CHEBI:83400, ChEBI:CHEBI:140626; EC=2.7.7.19;.

Enzyme Numbers (IUBMB) for PAPOLA Gene

Phenotypes From GWAS Catalog for PAPOLA Gene

Gene Ontology (GO) - Molecular Function for PAPOLA Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0000287 magnesium ion binding ISS --
GO:0003723 RNA binding IEA --
GO:0004652 polynucleotide adenylyltransferase activity IEA,TAS --
GO:0005515 protein binding IPI 7590244
genes like me logo Genes that share ontologies with PAPOLA: view
genes like me logo Genes that share phenotypes with PAPOLA: view

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAPOLA

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PAPOLA Gene

Localization for PAPOLA Gene

Subcellular locations from UniProtKB/Swiss-Prot for PAPOLA Gene

Cytoplasm. Nucleus. Note=The 90 kDa form is nuclear while the 100 kDa and the 106 kDa forms are both nuclear and cytoplasmic.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PAPOLA gene
Compartment Confidence
nucleus 5
cytosol 2
plasma membrane 1
extracellular 1
cytoskeleton 1
mitochondrion 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PAPOLA Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,TAS 8302877
GO:0005654 nucleoplasm IDA,TAS --
GO:0005737 cytoplasm TAS 8302877
genes like me logo Genes that share ontologies with PAPOLA: view

Pathways & Interactions for PAPOLA Gene

genes like me logo Genes that share pathways with PAPOLA: view

Pathways by source for PAPOLA Gene

SIGNOR curated interactions for PAPOLA Gene

Is activated by:

Gene Ontology (GO) - Biological Process for PAPOLA Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000398 mRNA splicing, via spliceosome TAS --
GO:0006369 termination of RNA polymerase II transcription TAS --
GO:0006378 mRNA polyadenylation IBA,IDA 7590244
GO:0006397 mRNA processing IEA --
GO:0031123 RNA 3'-end processing IEA --
genes like me logo Genes that share ontologies with PAPOLA: view

Drugs & Compounds for PAPOLA Gene

(5) Drugs for PAPOLA Gene - From: DrugBank and HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
3-Sulfinoalanine Experimental Pharma Target 0
Cordycepin Triphosphate Experimental Pharma Target 0
Triphosphoric acid Experimental Pharma Target 0
Phosphate Experimental Pharma 0
ATP Investigational Nutra 0

(2) Additional Compounds for PAPOLA Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • [(HO)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • Pyrophosphoric acid
14000-31-8
genes like me logo Genes that share compounds with PAPOLA: view

Transcripts for PAPOLA Gene

mRNA/cDNA for PAPOLA Gene

10 REFSEQ mRNAs :
23 NCBI additional mRNA sequence :
26 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAPOLA

Alternative Splicing Database (ASD) splice patterns (SP) for PAPOLA Gene

ExUns: 1a · 1b · 1c · 1d · 1e ^ 2 ^ 3 ^ 4a · 4b · 4c ^ 5a · 5b ^ 6 ^ 7a · 7b · 7c · 7d · 7e ^ 8 ^ 9a · 9b · 9c · 9d · 9e ^ 10 ^ 11a ·
SP1: - - - -
SP2: - - - - -
SP3: - - - - - -
SP4:
SP5:
SP6: - - - -
SP7: -
SP8: - - - -
SP9: - - - - - - - - -
SP10: - - -
SP11:
SP12:
SP13: - - - - -
SP14:
SP15:
SP16:
SP17:
SP18:
SP19:
SP20:
SP21:
SP22:

ExUns: 11b ^ 12a · 12b ^ 13a · 13b ^ 14a · 14b ^ 15a · 15b ^ 16 ^ 17a · 17b ^ 18 ^ 19 ^ 20 ^ 21 ^ 22a · 22b · 22c ^ 23a · 23b ^ 24a · 24b ^ 25a · 25b · 25c ·
SP1: - - - -
SP2: - -
SP3:
SP4: - -
SP5: - -
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12: -
SP13:
SP14: - - - -
SP15: - - -
SP16: -
SP17: - - -
SP18: -
SP19:
SP20:
SP21:
SP22:

ExUns: 25d · 25e
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:
SP18:
SP19:
SP20:
SP21:
SP22:

Relevant External Links for PAPOLA Gene

GeneLoc Exon Structure for
PAPOLA

Expression for PAPOLA Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PAPOLA Gene

Protein differential expression in normal tissues from HIPED for PAPOLA Gene

This gene is overexpressed in Peripheral blood mononuclear cells (16.0), Testis (9.4), and Lymph node (8.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for PAPOLA Gene



Protein tissue co-expression partners for PAPOLA Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PAPOLA

SOURCE GeneReport for Unigene cluster for PAPOLA Gene:

Hs.253726

Evidence on tissue expression from TISSUES for PAPOLA Gene

  • Nervous system(4.9)
  • Liver(4.4)
  • Spleen(2.5)
  • Intestine(2.5)
  • Eye(2.4)
  • Kidney(2.3)
  • Skin(2.3)
  • Muscle(2.2)
  • Blood(2.2)
  • Heart(2.1)
  • Lung(2)
  • Stomach(2)
genes like me logo Genes that share expression patterns with PAPOLA: view

Primer products for research

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PAPOLA Gene

Orthologs for PAPOLA Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PAPOLA Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia PAPOLA 29 30
  • 99.96 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia PAPOLA 29 30
  • 97.56 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia -- 30
  • 97 (a)
ManyToMany
-- 30
  • 87 (a)
ManyToMany
-- 30
  • 80 (a)
ManyToMany
Platypus
(Ornithorhynchus anatinus)
Mammalia -- 30
  • 97 (a)
OneToMany
Cow
(Bos Taurus)
Mammalia PAPOLA 29 30
  • 96.89 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Papola 29 16 30
  • 93.82 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Papola 29
  • 93.46 (n)
Chicken
(Gallus gallus)
Aves PAPOLA 29 30
  • 88.5 (n)
OneToMany
Lizard
(Anolis carolinensis)
Reptilia -- 30
  • 90 (a)
OneToMany
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia papola 29
  • 78.73 (n)
Str.10813 29
African clawed frog
(Xenopus laevis)
Amphibia MGC68746 29
Zebrafish
(Danio rerio)
Actinopterygii papola 29 30
  • 68.38 (n)
OneToMany
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.5723 29
Fruit Fly
(Drosophila melanogaster)
Insecta hrg 30
  • 50 (a)
OneToMany
Worm
(Caenorhabditis elegans)
Secernentea T15H9.6 29 30
  • 57.55 (n)
ManyToMany
F43G6.5 30
  • 47 (a)
ManyToMany
pap-1 30
  • 41 (a)
ManyToMany
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PAP1 30
  • 38 (a)
OneToMany
Thale Cress
(Arabidopsis thaliana)
eudicotyledons nPAP 29
  • 50.8 (n)
Rice
(Oryza sativa)
Liliopsida Os06g0558700 29
  • 52.14 (n)
Os.32564 29
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.2725 30
  • 64 (a)
OneToMany
Species where no ortholog for PAPOLA was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for PAPOLA Gene

ENSEMBL:
Gene Tree for PAPOLA (if available)
TreeFam:
Gene Tree for PAPOLA (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PAPOLA: view image
Alliance of Genome Resources:
Additional Orthologs for PAPOLA

Paralogs for PAPOLA Gene

Paralogs for PAPOLA Gene

(3) SIMAP similar genes for PAPOLA Gene using alignment to 9 proteins:

  • PAPOA_HUMAN
  • G3V2A0_HUMAN
  • G3V3I9_HUMAN
  • G3V457_HUMAN
  • G3XAH6_HUMAN
  • H0YJ00_HUMAN
  • H0YJL4_HUMAN
  • H0YJZ9_HUMAN
  • L8ECL5_HUMAN
genes like me logo Genes that share paralogs with PAPOLA: view

Variants for PAPOLA Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PAPOLA Gene

SNP ID Clinical significance and condition Chr 14 pos Variation AA Info Type
rs148378172 Benign: not provided 96,531,537(+) T/C
NM_032632.4(PAPOLA):c.558T>C (p.Asp186=)
SYNONYMOUS_VARIANT,FIVE_PRIME_UTR
rs149879119 Benign: not provided 96,552,590(+) C/T
NM_032632.4(PAPOLA):c.1632C>T (p.Thr544=)
SYNONYMOUS
rs200215413 Benign: not provided 96,502,607(+) A/C
NM_032632.4(PAPOLA):c.8+7A>C
INTRON
rs35861551 Benign: not provided 96,552,527(+) C/T
NM_032632.4(PAPOLA):c.1569C>T (p.Leu523=)
SYNONYMOUS
rs483352759 Conflicting Interpretations: not provided 96,547,861(+) A/G
NM_032632.4(PAPOLA):c.1464A>G (p.Val488=)
SYNONYMOUS

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for PAPOLA Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for PAPOLA Gene

Variant ID Type Subtype PubMed ID
dgv1964n100 CNV gain 25217958
nsv1052499 CNV loss 25217958
nsv977501 CNV duplication 23825009

Variation tolerance for PAPOLA Gene

Residual Variation Intolerance Score: 13.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.71; 15.05% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PAPOLA Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PAPOLA
Leiden Open Variation Database (LOVD)
PAPOLA

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PAPOLA Gene

Disorders for PAPOLA Gene

MalaCards: The human disease database

(2) MalaCards diseases for PAPOLA Gene - From: COP

- elite association - COSMIC cancer census association via MalaCards

Additional Disease Information for PAPOLA

genes like me logo Genes that share disorders with PAPOLA: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PAPOLA Gene

Publications for PAPOLA Gene

  1. Multiple forms of poly(A) polymerases in human cells. (PMID: 8302877) Thuresson AC … Virtanen A (Proceedings of the National Academy of Sciences of the United States of America 1994) 2 3 4 22
  2. Inositol 1,4,5-triphosphate receptor-binding protein released with inositol 1,4,5-triphosphate (IRBIT) associates with components of the mRNA 3' processing machinery in a phosphorylation-dependent manner and inhibits polyadenylation. (PMID: 19224921) Kiefer H … Mikoshiba K (The Journal of biological chemistry 2009) 3 4 22
  3. Human Fip1 is a subunit of CPSF that binds to U-rich RNA elements and stimulates poly(A) polymerase. (PMID: 14749727) Kaufmann I … Keller W (The EMBO journal 2004) 3 4 22
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
  5. Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization. (PMID: 15169763) Dettwiler S … Barabino SM (The Journal of biological chemistry 2004) 3 4

Products for PAPOLA Gene

Sources for PAPOLA Gene