This gene encodes a deadenylase that functions as the catalytic subunit of the polyadenylate binding protein dependent poly(A) nuclease complex. The encoded protein is a magnesium dependent 3' to 5' exoribonuclease that is involved in the degradation of cytoplasmic mRNAs. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] See more...

Aliases for PAN2 Gene

Aliases for PAN2 Gene

  • Poly(A) Specific Ribonuclease Subunit PAN2 2 3 5
  • PAN2-PAN3 Deadenylation Complex Catalytic Subunit PAN2 3 4
  • Inactive Ubiquitin Carboxyl-Terminal Hydrolase 52 3 4
  • Poly(A)-Nuclease Deadenylation Complex Subunit 2 3 4
  • PAB1P-Dependent Poly(A)-Specific Ribonuclease 3 4
  • PAN Deadenylation Complex Subunit 2 3 4
  • Ubiquitin Specific Peptidase 52 2 3
  • Ubiquitin Specific Protease 52 2 3
  • EC 3.1.13.4 4 51
  • KIAA0710 2 4
  • USP52 3 4
  • PAN2 Homolog, PABP1 Dependent Poly A Specific Ribonuclease Subunit (S. Cerevisiae) 2
  • PAN2 Poly(A) Specific Ribonuclease Subunit Homolog (S. Cerevisiae) 2
  • PAB-Dependent Poly(A)-Specific Ribonuclease Subunit PAN2 3
  • PAB-Dependent Poly(A)-Specific Ribonuclease Subunit 2 3
  • PAN2 Poly(A) Specific Ribonuclease Subunit Homolog 3
  • PAN Deadenylation Complex Catalytic Subunit 2 3
  • PAN2 Poly(A) Specific Ribonuclease Subunit 2
  • PAN2 PolyA Specific Ribonuclease Subunit 3
  • PABP-Dependent Poly(A) Nuclease 2 3
  • PAB1P-Dependent Poly(A)-Nuclease 3
  • HPAN2 2
  • PAN2 5

External Ids for PAN2 Gene

Previous HGNC Symbols for PAN2 Gene

  • USP52

Previous GeneCards Identifiers for PAN2 Gene

  • GC02M018621
  • GC12M054997
  • GC12M056710
  • GC12M053748

Summaries for PAN2 Gene

Entrez Gene Summary for PAN2 Gene

  • This gene encodes a deadenylase that functions as the catalytic subunit of the polyadenylate binding protein dependent poly(A) nuclease complex. The encoded protein is a magnesium dependent 3' to 5' exoribonuclease that is involved in the degradation of cytoplasmic mRNAs. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

GeneCards Summary for PAN2 Gene

PAN2 (Poly(A) Specific Ribonuclease Subunit PAN2) is a Protein Coding gene. Among its related pathways are Deadenylation-dependent mRNA decay and Ectoderm Differentiation. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and exonuclease activity.

UniProtKB/Swiss-Prot Summary for PAN2 Gene

  • Catalytic subunit of the poly(A)-nuclease (PAN) deadenylation complex, one of two cytoplasmic mRNA deadenylases involved in general and miRNA-mediated mRNA turnover. PAN specifically shortens poly(A) tails of RNA and the activity is stimulated by poly(A)-binding protein (PABP). PAN deadenylation is followed by rapid degradation of the shortened mRNA tails by the CCR4-NOT complex. Deadenylated mRNAs are then degraded by two alternative mechanisms, namely exosome-mediated 3'-5' exonucleolytic degradation, or deadenlyation-dependent mRNA decaping and subsequent 5'-3' exonucleolytic degradation by XRN1. Also acts as an important regulator of the HIF1A-mediated hypoxic response. Required for HIF1A mRNA stability independent of poly(A) tail length regulation.

Gene Wiki entry for PAN2 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PAN2 Gene

Genomics for PAN2 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for PAN2 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH12J056332 Promoter/Enhancer 2.4 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 600.7 +0.1 86 2.9 SP1 CREB1 CTCF PRDM10 REST ZNF629 LEF1 IKZF1 NFKBIZ KDM1A IL23A PAN2 ENSG00000257303 lnc-CNPY2-3 CNPY2
GH12J056336 Enhancer 0.5 FANTOM5 dbSUPER 600.7 -1.5 -1542 0.2 MTA2 SMARCA5 IL23A PAN2 lnc-COQ10A-3 STAT2
GH12J057109 Promoter/Enhancer 2.5 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 121.8 -777.2 -777248 4.2 ARHGAP35 CEBPG CREB1 GATAD2A CTCF PRDM10 ZNF629 TFE3 LEF1 IKZF1 STAT6 lnc-LRP1-4 NEMP1 EEF1AKMT3 ENSG00000257740 BAZ2A PAN2 SMARCC2 ANKRD52 CDK4
GH12J056220 Promoter/Enhancer 2.4 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 87.3 +111.2 111197 5.7 ZNF221 SP1 CREB1 GATAD2A CTCF TEAD4 PRDM10 REST ZNF629 RFX1 NABP2 RNF41 lnc-RNF41-1 NEMP1 PAN2 BAZ2A PHC1P1 ANKRD52 ZBTB39 TMEM198B
GH12J056266 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE CraniofacialAtlas 89.9 +66.9 66852 2.4 CREB1 GATAD2A CTCF PRDM10 ZNF629 TFE3 RFX1 SIX5 NFKBIZ RFX5 COQ10A NEMP1 PAN2 BAZ2A DNAJC14 ANKRD52 PHC1P1 ZBTB39 TMEM198B SMARCC2
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PAN2 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PAN2

Top Transcription factor binding sites by QIAGEN in the PAN2 gene promoter:
  • CUTL1
  • STAT3
  • STAT5A

Genomic Locations for PAN2 Gene

Genomic Locations for PAN2 Gene
chr12:56,316,223-56,334,053
(GRCh38/hg38)
Size:
17,831 bases
Orientation:
Minus strand
chr12:56,710,007-56,727,837
(GRCh37/hg19)
Size:
17,831 bases
Orientation:
Minus strand

Genomic View for PAN2 Gene

Genes around PAN2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PAN2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PAN2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PAN2 Gene

Proteins for PAN2 Gene

  • Protein details for PAN2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q504Q3-PAN2_HUMAN
    Recommended name:
    PAN2-PAN3 deadenylation complex catalytic subunit PAN2
    Protein Accession:
    Q504Q3
    Secondary Accessions:
    • O75189
    • Q76E12
    • Q8IVE1

    Protein attributes for PAN2 Gene

    Size:
    1202 amino acids
    Molecular mass:
    135368 Da
    Cofactor:
    Name=a divalent metal cation; Xref=ChEBI:CHEBI:60240;
    Quaternary structure:
    • Forms a heterotrimer with an asymmetric homodimer of the regulatory subunit PAN3 to form the poly(A)-nuclease (PAN) deadenylation complex (PubMed:14583602, PubMed:23932717). Interacts with ZFP36 (By similarity).
    SequenceCaution:
    • Sequence=BAA31685.2; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305};

    Alternative splice isoforms for PAN2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PAN2 Gene

Selected DME Specific Peptides for PAN2 Gene

Q504Q3:
  • EQVVDYLT
  • IEDARTAL
  • GQCQFCEPTGLANPADIFHVN
  • GLACDRFLKVYDLRMMRA
  • DWKVPEP
  • LERYSSFQVN
  • RGGLIIFDYL
  • SGSLSDFDVHGNLL
  • MTFDVSASKQALAFGDSEGCVHLW
  • VYVYDLMATVVHILDSRTGGSLV
  • LRNQIPYRLKE
  • WNRFILTQLHQ
  • VEHEFDA
  • HIKVGETYHQRKEGVTHQQWYLFNDFLIEP
  • LVINCEVNSSKEADFW
  • PLSLIPVPLT
  • QNHLCQKEFCL
  • HGGHATSFFGP
  • FLRFIPTYTSRLAIISQ
  • EILRTMKKVGFIGYAPNPRT
  • EIDLNTVQETQKY
  • WKVPAILYY
  • GVKFVGHGLQKDFRVINLMVPKDQV
  • PQAYRGAG
  • KKYRKVTIKYSKLGLEDFDFKHYNKTLFAGLEPHIPNAYC
  • RSDGTKSTIKPS
  • HDSIEDA
  • TFIPLML
  • HLNPSLLQNVELDPEGV
  • EAVQFDM

Post-translational modifications for PAN2 Gene

  • Ubiquitination at Lys706
  • Modification sites at PhosphoSitePlus

Domains & Families for PAN2 Gene

Gene Families for PAN2 Gene

Protein Domains for PAN2 Gene

InterPro:
Blocks:
  • Exonuclease
  • Ubiquitin thiolesterase, family 2
  • Exonuclease, RNase T and DNA polymerase III
ProtoNet:

Suggested Antigen Peptide Sequences for PAN2 Gene

GenScript: Design optimal peptide antigens:
  • Inactive ubiquitin carboxyl-terminal hydrolase 52 (PAN2_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q504Q3

UniProtKB/Swiss-Prot:

PAN2_HUMAN :
  • Contains a pseudo-UCH domain. This ubiquitin C-terminal hydrolase (UCH)-like or ubiquitin specific protease (USP)-like domain is predicted to be catalytically inactive because it lacks the active site catalytic triad characteristic of thiol proteases, with residues at the equivalent structural positions that are incompatible with catalysis, and it cannot bind ubiquitin. It functions as a structural scaffold for intra- and intermolecular interactions in the complex.
  • Belongs to the peptidase C19 family. PAN2 subfamily.
Domain:
  • Contains a pseudo-UCH domain. This ubiquitin C-terminal hydrolase (UCH)-like or ubiquitin specific protease (USP)-like domain is predicted to be catalytically inactive because it lacks the active site catalytic triad characteristic of thiol proteases, with residues at the equivalent structural positions that are incompatible with catalysis, and it cannot bind ubiquitin. It functions as a structural scaffold for intra- and intermolecular interactions in the complex.
  • The linker, or PAN3 interaction domain (PID), between the WD40 repeats and the pseudo-UCH domain mediates interaction with PAN3.
Family:
  • Belongs to the peptidase C19 family. PAN2 subfamily.
genes like me logo Genes that share domains with PAN2: view

Function for PAN2 Gene

Molecular function for PAN2 Gene

UniProtKB/Swiss-Prot Function:
Catalytic subunit of the poly(A)-nuclease (PAN) deadenylation complex, one of two cytoplasmic mRNA deadenylases involved in general and miRNA-mediated mRNA turnover. PAN specifically shortens poly(A) tails of RNA and the activity is stimulated by poly(A)-binding protein (PABP). PAN deadenylation is followed by rapid degradation of the shortened mRNA tails by the CCR4-NOT complex. Deadenylated mRNAs are then degraded by two alternative mechanisms, namely exosome-mediated 3'-5' exonucleolytic degradation, or deadenlyation-dependent mRNA decaping and subsequent 5'-3' exonucleolytic degradation by XRN1. Also acts as an important regulator of the HIF1A-mediated hypoxic response. Required for HIF1A mRNA stability independent of poly(A) tail length regulation.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=Exonucleolytic cleavage of poly(A) to 5'-AMP.; EC=3.1.13.4; Evidence={ECO:0000255|HAMAP-Rule:MF_03182, ECO:0000269|PubMed:14583602};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Positively regulated by the regulatory subunit PAN3.

Enzyme Numbers (IUBMB) for PAN2 Gene

Phenotypes From GWAS Catalog for PAN2 Gene

Gene Ontology (GO) - Molecular Function for PAN2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000175 3'-5'-exoribonuclease activity IDA 14583602
GO:0003676 nucleic acid binding IEA --
GO:0004518 nuclease activity IEA --
GO:0004527 exonuclease activity IEA --
GO:0004535 poly(A)-specific ribonuclease activity TAS --
genes like me logo Genes that share ontologies with PAN2: view
genes like me logo Genes that share phenotypes with PAN2: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAN2

Clone Products

  • Addgene plasmids for PAN2

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PAN2 Gene

Localization for PAN2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PAN2 Gene

Cytoplasm. Cytoplasm, P-body. Nucleus. Note=Shuttles between nucleus and cytoplasm. {ECO:0000255 HAMAP-Rule:MF_03182, ECO:0000269 PubMed:16284618}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PAN2 gene
Compartment Confidence
nucleus 4
cytosol 4
extracellular 1
cytoskeleton 1
mitochondrion 1
endoplasmic reticulum 1

Gene Ontology (GO) - Cellular Components for PAN2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000932 P-body IEA,IBA 21873635
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
GO:0031251 PAN complex IBA,IDA 14583602
genes like me logo Genes that share ontologies with PAN2: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for PAN2 Gene

Pathways & Interactions for PAN2 Gene

genes like me logo Genes that share pathways with PAN2: view

Pathways by source for PAN2 Gene

1 BioSystems pathway for PAN2 Gene
1 KEGG pathway for PAN2 Gene
1 Qiagen pathway for PAN2 Gene
  • Ubiquitin-Proteasome Dependent Proteolysis

Gene Ontology (GO) - Biological Process for PAN2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay IEA --
GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening IBA,TAS --
GO:0006397 mRNA processing IEA --
GO:0010606 positive regulation of cytoplasmic mRNA processing body assembly IEA --
GO:0090305 nucleic acid phosphodiester bond hydrolysis IEA --
genes like me logo Genes that share ontologies with PAN2: view

No data available for SIGNOR curated interactions for PAN2 Gene

Drugs & Compounds for PAN2 Gene

No Compound Related Data Available

Transcripts for PAN2 Gene

mRNA/cDNA for PAN2 Gene

3 REFSEQ mRNAs :
10 NCBI additional mRNA sequence :
21 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAN2

Clone Products

  • Addgene plasmids for PAN2

Alternative Splicing Database (ASD) splice patterns (SP) for PAN2 Gene

ExUns: 1a · 1b · 1c ^ 2a · 2b ^ 3 ^ 4 ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10a · 10b · 10c ^ 11 ^ 12a · 12b ^ 13 ^ 14 ^ 15a · 15b · 15c ^ 16a · 16b ^
SP1: - - - - -
SP2: - - - -
SP3: - -
SP4: - - -
SP5:
SP6:
SP7: - -
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:

ExUns: 17a · 17b ^ 18a · 18b ^ 19 ^ 20 ^ 21a · 21b · 21c ^ 22a · 22b ^ 23a · 23b ^ 24 ^ 25 ^ 26 ^ 27a · 27b · 27c ^ 28 ^ 29 ^ 30a · 30b · 30c · 30d
SP1: - - - -
SP2: - - - -
SP3: - - - -
SP4: - - -
SP5:
SP6:
SP7:
SP8:
SP9:
SP10: - -
SP11:
SP12:
SP13:
SP14:
SP15: -

Relevant External Links for PAN2 Gene

GeneLoc Exon Structure for
PAN2

Expression for PAN2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PAN2 Gene

Protein differential expression in normal tissues from HIPED for PAN2 Gene

This gene is overexpressed in Serum (13.3), Plasma (13.1), and Peripheral blood mononuclear cells (6.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PAN2 Gene



Protein tissue co-expression partners for PAN2 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PAN2

SOURCE GeneReport for Unigene cluster for PAN2 Gene:

Hs.273397

Evidence on tissue expression from TISSUES for PAN2 Gene

  • Nervous system(4.8)
  • Eye(4.1)
  • Skin(2.3)
  • Kidney(2.2)
genes like me logo Genes that share expression patterns with PAN2: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PAN2 Gene

Orthologs for PAN2 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for PAN2 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia LOC451995 30
  • 99.56 (n)
Dog
(Canis familiaris)
Mammalia PAN2 30 31
  • 93.01 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia PAN2 30 31
  • 92.84 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Pan2 30 17 31
  • 89.86 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Pan2 30
  • 89.55 (n)
Platypus
(Ornithorhynchus anatinus)
Mammalia PAN2 31
  • 74 (a)
OneToOne
Chicken
(Gallus gallus)
Aves PAN2 30 31
  • 77.94 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia PAN2 31
  • 84 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia pan2 30
  • 72.76 (n)
Str.4361 30
African clawed frog
(Xenopus laevis)
Amphibia Xl.6934 30
Zebrafish
(Danio rerio)
Actinopterygii pan2 31
  • 74 (a)
OneToOne
LOC792831 30
  • 70.98 (n)
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.2883 30
Fruit Fly
(Drosophila melanogaster)
Insecta CG8232 30 31
  • 52.78 (n)
OneToOne
CG2070 32
  • 48 (a)
CG2065 32
  • 47 (a)
CG3842 32
  • 47 (a)
CG2064 32
  • 45 (a)
CG7675 32
  • 44 (a)
CG30491 32
  • 43 (a)
CG30495 32
  • 43 (a)
CG11200 32
  • 38 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP010626 30
  • 52.24 (n)
Worm
(Caenorhabditis elegans)
Secernentea panl-2 31
  • 27 (a)
OneToOne
A. gosspyii yeast
(Eremothecium gossypii)
Saccharomycetes AGOS_AFL055W 30
  • 44.99 (n)
K. Lactis Yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0E18877g 30
  • 43.82 (n)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PAN2 30 31
  • 42.77 (n)
OneToOne
Bread mold
(Neurospora crassa)
Ascomycetes NCU10733 30
  • 46.51 (n)
Fission Yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes ubp13 30
  • 45.77 (n)
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.723 31
  • 45 (a)
OneToOne
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.865 30
Species where no ortholog for PAN2 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Oppossum (Monodelphis domestica)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for PAN2 Gene

ENSEMBL:
Gene Tree for PAN2 (if available)
TreeFam:
Gene Tree for PAN2 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PAN2: view image

Paralogs for PAN2 Gene

No data available for Paralogs for PAN2 Gene

Variants for PAN2 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PAN2 Gene

SNP ID Clinical significance and condition Chr 12 pos Variation AA Info Type
717735 Likely Benign: not provided 56,324,597(-) C/T MISSENSE_VARIANT
730839 Benign: not provided 56,323,810(-) G/A SYNONYMOUS_VARIANT
785414 Benign: not provided 56,324,325(-) T/C MISSENSE_VARIANT
rs1330054285 A colorectal cancer sample p.Ala1201Val
rs11558139 - p.Ser32Asn

Additional dbSNP identifiers (rs#s) for PAN2 Gene

Structural Variations from Database of Genomic Variants (DGV) for PAN2 Gene

Variant ID Type Subtype PubMed ID
nsv482992 CNV gain+loss 15286789

Variation tolerance for PAN2 Gene

Residual Variation Intolerance Score: 12.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.51; 43.90% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PAN2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PAN2

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PAN2 Gene

Disorders for PAN2 Gene

Additional Disease Information for PAN2

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform

No disorders were found for PAN2 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PAN2 Gene

Publications for PAN2 Gene

  1. Identification of a human cytoplasmic poly(A) nuclease complex stimulated by poly(A)-binding protein. (PMID: 14583602) Uchida N … Katada T (The Journal of biological chemistry 2004) 2 3 4
  2. The P-body component USP52/PAN2 is a novel regulator of HIF1A mRNA stability. (PMID: 23398456) Bett JS … Hay RT (The Biochemical journal 2013) 3 4
  3. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey SD … DREAM investigators (Diabetes care 2010) 3 41
  4. A probability-based approach for high-throughput protein phosphorylation analysis and site localization. (PMID: 16964243) Beausoleil SA … Gygi SP (Nature biotechnology 2006) 3 4
  5. Concerted action of poly(A) nucleases and decapping enzyme in mammalian mRNA turnover. (PMID: 16284618) Yamashita A … Shyu AB (Nature structural & molecular biology 2005) 3 4

Products for PAN2 Gene

Sources for PAN2 Gene