OLA1 Gene (Protein Coding)

Obg Like ATPase 1

GC02M174072
GIFtS:
44
This gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has been observed in multiple types of cancer and may be associated with poor survival. Pseudogenes of this gene have been defin... See more...

Aliases for OLA1 Gene

Aliases for OLA1 Gene

  • Obg Like ATPase 1 2 3 5
  • GTP-Binding Protein 9 (Putative) 2 3
  • Obg-Like ATPase 1 3 4
  • GTPBP9 3 4
  • DOC45 3 4
  • DNA Damage-Regulated Overexpressed In Cancer 45 Protein 3
  • DNA Damage-Regulated Overexpressed In Cancer 45 4
  • Homologous Yeast-44.2 Protein 3
  • GTP-Binding Protein PTD004 3
  • GTP-Binding Protein 9 4
  • EC 3.6.3 52
  • PTD004 3
  • GBP45 3
  • GTBP9 3

External Ids for OLA1 Gene

Previous HGNC Symbols for OLA1 Gene

  • GTPBP9

Previous GeneCards Identifiers for OLA1 Gene

  • GC02M174646
  • GC02M174937
  • GC02M166816

Summaries for OLA1 Gene

Entrez Gene Summary for OLA1 Gene

  • This gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has been observed in multiple types of cancer and may be associated with poor survival. Pseudogenes of this gene have been defined on chromosomes 17 and 22. [provided by RefSeq, Jun 2016]

GeneCards Summary for OLA1 Gene

OLA1 (Obg Like ATPase 1) is a Protein Coding gene. Diseases associated with OLA1 include Breast Cancer. Among its related pathways are Response to elevated platelet cytosolic Ca2+. Gene Ontology (GO) annotations related to this gene include GTP binding and ribosome binding.

UniProtKB/Swiss-Prot Summary for OLA1 Gene

  • Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.

Gene Wiki entry for OLA1 Gene

Additional gene information for OLA1 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for OLA1 Gene

Genomics for OLA1 Gene

GeneHancer (GH) Regulatory Elements for OLA1 Gene

Promoters and enhancers for OLA1 Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH02J174246 Promoter/Enhancer 2 EPDnew Ensembl ENCODE CraniofacialAtlas 505.2 +0.5 516 2.6 HNRNPK ZBTB40 ZNF217 SIN3A NRF1 TCF12 MYC USF1 POLR2G SP1 OLA1 lnc-SP9-11 SP9 RF00017-3366 RN7SL65P
GH02J174249 Enhancer 0.4 ENCODE 500.7 -1.1 -1131 0.2 ZNF644 ZMYM3 MZF1 OLA1 lnc-SP9-11 RF00017-3367
GH02J175180 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE CraniofacialAtlas 10.3 -932.7 -932663 2.6 ZBTB40 ZNF217 EP300 CTCF SIN3A NRF1 TCF12 POLR2G SP1 NCOR1 lnc-ATF2-1 lnc-SCRN3-10 piR-59456 ATF2 ATP5MC3 HOXD9 HOXD4 CHN1 HOXD10 OLA1
GH02J174394 Promoter/Enhancer 2 EPDnew Ensembl ENCODE CraniofacialAtlas 10.4 -146.9 -146912 3.1 FOXK2 ZBTB40 ZNF217 EP300 SIN3A POLR2G NCOR1 PHF8 ZFX ZNF10 SCRN3 CIR1 L13304-021 L13705-009 lnc-GPR155-2 CHN1 OLA1 GPR155 lnc-GPR155-3
GH02J174117 Enhancer 1.6 VISTA UCNEbase Ensembl ENCODE 9.8 +127.0 127036 9.2 EP300 ZSCAN5C JUND FOS ZIC2 CUX1 FOXA2 ZNF384 FOSL1 FOSL2 OLA1 RF00994-536 lnc-SP3-10
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around OLA1 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for OLA1

Top Transcription factor binding sites by QIAGEN in the OLA1 gene promoter:
  • AREB6
  • COMP1
  • HNF-4alpha1
  • HNF-4alpha2
  • ITF-2
  • S8
  • Tal-1beta
  • TBP
  • USF-1
  • USF1

Genomic Locations for OLA1 Gene

Genomic Locations for OLA1 Gene
chr2:174,072,447-174,248,637
(GRCh38/hg38)
Size:
176,191 bases
Orientation:
Minus strand
chr2:174,937,175-175,113,426
(GRCh37/hg19)
Size:
176,252 bases
Orientation:
Minus strand

Genomic View for OLA1 Gene

Genes around OLA1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
OLA1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for OLA1 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for OLA1 Gene

Proteins for OLA1 Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for OLA1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9NTK5-OLA1_HUMAN
    Recommended name:
    Obg-like ATPase 1
    Protein Accession:
    Q9NTK5
    Secondary Accessions:
    • D7EHM2
    • Q5BJD7
    • Q8NCI8
    • Q96CU1
    • Q96SV2
    • Q9P1D3
    • Q9UNY9
    • Q9Y6G4

    Protein attributes for OLA1 Gene

    Size:
    396 amino acids
    Molecular mass:
    44744 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Monomer.

    Three dimensional structures from OCA and Proteopedia for OLA1 Gene

    Alternative splice isoforms for OLA1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for OLA1 Gene

Protein Expression for OLA1 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for OLA1 Gene

Q9NTK5:
  • NLSEKDYIRKKNKWLIKIKEWVDK
  • YHDWNDKEI
  • DFKEEGSE
  • RAFEDDDITHVEGSVDP
  • ACDGIFHL
  • EGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQ
  • GKSTFFNVLT
  • PAFLNVVDIAGLVKGA
  • AENFPFCTI
  • KGTKAPQAAGKIHTDFEKGFIMAEVMK
  • PNESRVPVPD
  • AVRGGDKKLKPEYDIMCKVKSWV
  • RDIEIIHEEL
  • GQGLGNAFLS
  • NMTQSALPKIIKAG
  • DPGALVIP
  • LEKVAVR

Post-translational modifications for OLA1 Gene

  • Ubiquitination at Lys190, Lys83, and Lys281
  • Modification sites at PhosphoSitePlus

Other Protein References for OLA1 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for OLA1 Gene

Gene Families for OLA1 Gene

Human Protein Atlas (HPA):
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for OLA1 Gene

Blocks:
  • GTP-binding protein, HSR1-related
  • GTP1/OBG GTP-binding protein family signature
  • Protein of unknown function DUF933
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for OLA1 Gene

GenScript: Design optimal peptide antigens:
  • GTP-binding protein PTD004, isoform CRA_c (D7EHM2_HUMAN)
  • GTP-binding protein 9 (OLA1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9NTK5

UniProtKB/Swiss-Prot:

OLA1_HUMAN :
  • Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily. OBG GTPase family. YchF/OLA1 subfamily.
Family:
  • Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily. OBG GTPase family. YchF/OLA1 subfamily.
genes like me logo Genes that share domains with OLA1: view

Function for OLA1 Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line

Molecular function for OLA1 Gene

UniProtKB/Swiss-Prot Function:
Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.
UniProtKB/Swiss-Prot Induction:
Strongly down-regulated by DNA damage-inducing agents.

Enzyme Numbers (IUBMB) for OLA1 Gene

Phenotypes From GWAS Catalog for OLA1 Gene

Gene Ontology (GO) - Molecular Function for OLA1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 22190034
GO:0005524 ATP binding IDA,IEA 17430889
GO:0005525 GTP binding IEA --
GO:0016787 hydrolase activity IEA --
GO:0016887 ATPase activity IEA,IDA 17430889
genes like me logo Genes that share ontologies with OLA1: view
genes like me logo Genes that share phenotypes with OLA1: view

Animal Models for OLA1 Gene

MGI Knock Outs for OLA1:
  • Ola1 Ola1<tm1.2Zshi>

Animal Model Products

  • Taconic Biosciences Mouse Models for OLA1

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for OLA1

Clone Products

  • Addgene plasmids for OLA1

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for OLA1 Gene

Localization for OLA1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for OLA1 Gene

Cytoplasm. Nucleus. Nucleus, nucleolus. Note=Predominantly cytoplasmic, shuttles between the nucleus and the cytoplasm. {ECO:0000255 HAMAP-Rule:MF_03167}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for OLA1 gene
Compartment Confidence
cytoskeleton 5
cytosol 5
extracellular 4
nucleus 3
mitochondrion 2
plasma membrane 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (4)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for OLA1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region TAS --
GO:0005634 nucleus IEA --
GO:0005730 nucleolus IEA --
GO:0005737 cytoplasm IEA,IDA --
GO:0005813 centrosome IDA --
genes like me logo Genes that share ontologies with OLA1: view

Pathways & Interactions for OLA1 Gene

genes like me logo Genes that share pathways with OLA1: view

Gene Ontology (GO) - Biological Process for OLA1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002576 platelet degranulation TAS --
GO:0046034 ATP metabolic process IDA 17430889
genes like me logo Genes that share ontologies with OLA1: view

No data available for SIGNOR curated interactions for OLA1 Gene

Drugs & Compounds for OLA1 Gene

Products:

  1. Drug

(4) Drugs for OLA1 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
Guanosine triphosphate Experimental Pharma 0
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0

(1) Additional Compounds for OLA1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
 Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor 58-64-0
genes like me logo Genes that share compounds with OLA1: view

Transcripts for OLA1 Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone

mRNA/cDNA for OLA1 Gene

3 REFSEQ mRNAs :
18 NCBI additional mRNA sequence :
9 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for OLA1

Clone Products

  • Addgene plasmids for OLA1

Alternative Splicing Database (ASD) splice patterns (SP) for OLA1 Gene

ExUns: 1a · 1b · 1c · 1d · 1e ^ 2 ^ 3 ^ 4a · 4b ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10a · 10b ^ 11a · 11b ^ 12a · 12b · 12c ^ 13a · 13b ^ 14
SP1: - - -
SP2: - - -
SP3: - - -
SP4: - - - -
SP5: - - - - - - -
SP6: -
SP7: - -
SP8:
SP9:

Relevant External Links for OLA1 Gene

GeneLoc Exon Structure for
OLA1

Expression for OLA1 Gene

Products:

  1. Primer
  2. Gene Expression Assay

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for OLA1 Gene

mRNA expression in normal human tissues for OLA1 Gene
mRNA expression by BioGPS for OLA1 GenemRNA expression by GTEx for OLA1 Gene

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for OLA1 Gene



Protein tissue co-expression partners for OLA1 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for OLA1

SOURCE GeneReport for Unigene cluster for OLA1 Gene:

Hs.157351

mRNA Expression by UniProt/SwissProt for OLA1 Gene:

Q9NTK5-OLA1_HUMAN
Tissue specificity: Expressed in all tissues tested but its expression is more abundant in testis, liver, lung, and brain. Overexpressed in several malignancies, including cancers of the colon, rectum, ovary, lung, stomach, and uterus.

Evidence on tissue expression from TISSUES for OLA1 Gene

  • Nervous system(4.9)
  • Liver(4.4)
genes like me logo Genes that share expression patterns with OLA1: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for OLA1 Gene

Orthologs for OLA1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for OLA1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia OLA1 31 30
  • 100 (n)
 OneToOne
dog
(Canis familiaris)
 Mammalia OLA1 31 30
  • 97.14 (n)
 OneToOne
cow
(Bos Taurus)
 Mammalia OLA1 31 30
  • 96.46 (n)
 OneToOne
platypus
(Ornithorhynchus anatinus)
 Mammalia OLA1 31
  • 94 (a)
 OneToOne
mouse
(Mus musculus)
 Mammalia Ola1 17 31 30
  • 93.43 (n)
rat
(Rattus norvegicus)
 Mammalia Ola1 30
  • 92.93 (n)
oppossum
(Monodelphis domestica)
 Mammalia OLA1 31
  • 89 (a)
 OneToOne
chicken
(Gallus gallus)
 Aves OLA1 31 30
  • 86.2 (n)
 OneToOne
lizard
(Anolis carolinensis)
 Reptilia OLA1 31
  • 91 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia ola1 30
  • 80.98 (n)
Str.9014 30
African clawed frog
(Xenopus laevis)
 Amphibia MGC54033 30
zebrafish
(Danio rerio)
 Actinopterygii ola1 31 30
  • 76.18 (n)
 OneToOne
wufc66b09 30
fruit fly
(Drosophila melanogaster)
 Insecta CG1354 31 30
  • 64.6 (n)
 OneToOne
African malaria mosquito
(Anopheles gambiae)
 Insecta AgaP_AGAP000672 30
  • 64.08 (n)
worm
(Caenorhabditis elegans)
 Secernentea ola-1 31
  • 68 (a)
 OneToOne
tag-210 30
  • 63.27 (n)
baker's yeast
(Saccharomyces cerevisiae)
 Saccharomycetes OLA1 33 31 30
  • 58.64 (n)
K. lactis yeast
(Kluyveromyces lactis)
 Saccharomycetes KLLA0D03608g 30
  • 57.59 (n)
A. gosspyii yeast
(Ashbya gossypii)
 Saccharomycetes AGOS_AEL192W 30
  • 54.19 (n)
thale cress
(Arabidopsis thaliana)
 eudicotyledons AT1G30580 30
  • 62.41 (n)
Alicante grape
(Vitis vinifera)
 eudicotyledons Vvi.724 30
soybean
(Glycine max)
 eudicotyledons Gma.2708 30
rice
(Oryza sativa)
 Liliopsida Os08g0199300 30
  • 61.48 (n)
Os.9634 30
barley
(Hordeum vulgare)
 Liliopsida Hv.3018 30
corn
(Zea mays)
 Liliopsida Zm.968 30
wheat
(Triticum aestivum)
 Liliopsida Ta.2982 30
sea squirt
(Ciona savignyi)
 Ascidiacea CSA.5782 31
  • 71 (a)
 OneToOne
Cin.3463 30
fission yeast
(Schizosaccharomyces pombe)
 Schizosaccharomycetes SPAC27E2.03c 30
  • 58.14 (n)
bread mold
(Neurospora crassa)
 Ascomycetes NCU02044 30
  • 55.58 (n)
sea squirt
(Ciona intestinalis)
 Ascidiacea Cin.3463 30
Species where no ortholog for OLA1 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for OLA1 Gene

ENSEMBL:
Gene Tree for OLA1 (if available)
TreeFam:
Gene Tree for OLA1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for OLA1: view image

Paralogs for OLA1 Gene

(1) SIMAP similar genes for OLA1 Gene using alignment to 4 proteins:

  • OLA1_HUMAN
  • C9JCJ9_HUMAN
  • C9JTK6_HUMAN
  • J3KQ32_HUMAN

Pseudogenes.org Pseudogenes for OLA1 Gene

genes like me logo Genes that share paralogs with OLA1: view

No data available for Paralogs for OLA1 Gene

Variants for OLA1 Gene

Products:

  1. SNP Genotyping and Copy Number Assay

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for OLA1 Gene

SNP ID Clinical significance and condition Chr 02 pos Variation AA Info Type
rs193920787 Uncertain Significance: Malignant tumor of prostate 174,082,006(-) A/C MISSENSE_VARIANT,INTRON_VARIANT
VAR_036613 A breast cancer sample p.Glu168Gln

Additional dbSNP identifiers (rs#s) for OLA1 Gene

Structural Variations from Database of Genomic Variants (DGV) for OLA1 Gene

Variant ID Type Subtype PubMed ID
dgv2096n106 CNV deletion 24896259
esv2721155 CNV deletion 23290073
esv3438023 CNV insertion 20981092
esv3560566 CNV deletion 23714750
esv3593399 CNV gain 21293372
esv3593400 CNV loss 21293372
esv3866 CNV loss 18987735
esv5452 CNV loss 19470904
esv991222 CNV deletion 20482838
nsv1071639 CNV deletion 25765185
nsv1129210 CNV insertion 24896259
nsv3040 CNV deletion 18451855
nsv477550 CNV novel sequence insertion 20440878
nsv954712 CNV deletion 24416366

Variation tolerance for OLA1 Gene

Residual Variation Intolerance Score: 41.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.65; 72.75% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for OLA1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
OLA1

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for OLA1 Gene

Disorders for OLA1 Gene

MalaCards: The human disease database

(1) MalaCards diseases for OLA1 Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
breast cancer
  • breast cancer, familial
- elite association - COSMIC cancer census association via MalaCards
Search OLA1 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for OLA1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with OLA1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for OLA1 Gene

Publications for OLA1 Gene

  1. Human OLA1 defines an ATPase subfamily in the Obg family of GTP-binding proteins. (PMID: 17430889) Koller-Eichhorn R … Kambach C (The Journal of biological chemistry 2007) 2 3 4 54
  2. Regulation of cell-matrix adhesion by OLA1, the Obg-like ATPase 1. (PMID: 24486488) Jeyabal PV … Shi ZZ (Biochemical and biophysical research communications 2014) 2 3 54
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 41 54
  4. DOC45, a novel DNA damage-regulated nucleocytoplasmic ATPase that is overexpressed in multiple human malignancies. (PMID: 20053727) Sun H … Huang Y (Molecular cancer research : MCR 2010) 3 4 54
  5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 54

ExternalLinks

View latest publications for OLA1 gene in Mastermind

Products for OLA1 Gene

  • Addgene plasmids for OLA1

Sources for OLA1 Gene