Aliases for OLA1 Gene
Aliases for OLA1 Gene
External Ids for OLA1 Gene
- HGNC: 28833
- Entrez Gene: 29789
- Ensembl: ENSG00000138430
- OMIM: 611175
- UniProtKB: Q9NTK5
Previous HGNC Symbols for OLA1 Gene
- GTPBP9
Previous GeneCards Identifiers for OLA1 Gene
- GC02M174646
- GC02M174937
- GC02M166816
Summaries for OLA1 Gene
-
This gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has been observed in multiple types of cancer and may be associated with poor survival. Pseudogenes of this gene have been defined on chromosomes 17 and 22. [provided by RefSeq, Jun 2016]
GeneCards Summary for OLA1 Gene
OLA1 (Obg Like ATPase 1) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+. Gene Ontology (GO) annotations related to this gene include GTP binding and ribosome binding.
UniProtKB/Swiss-Prot for OLA1 Gene
-
Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for OLA1 Gene
Genomics for OLA1 Gene
GeneHancer (GH) Regulatory Elements for OLA1 Gene
Promoters and enhancers for OLA1 Gene
| GeneHancer (GH) Identifier | GH Type | GH Score |
GH Sources | Gene Association Score | Total Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites |
Gene Targets |
|---|---|---|---|---|---|---|---|---|---|---|
| GH02I174246 | Promoter/Enhancer | 2.1 | EPDnew Ensembl ENCODE | 555.3 | +0.6 | 575 | 2.6 | SMAD1 MLX ARNT ZFP64 ARID4B SIN3A DMAP1 ZNF2 IRF4 YY1 | OLA1 SP3 ENSG00000271151 CIR1 SP9 RN7SL65P | |
| GH02I174249 | Enhancer | 0.4 | ENCODE | 550.8 | -1.1 | -1070 | 0.2 | MZF1 ZMYM3 ZNF644 | OLA1 GC02M174265 ENSG00000201088 | |
| GH02I174325 | Promoter/Enhancer | 1.3 | Ensembl ENCODE | 10.3 | -77.5 | -77500 | 0.8 | ATF1 RB1 ARNT ZNF335 ZNF121 POLR2B EGR1 ZNF143 ATF7 EGR2 | LINC01305 OLA1 GPR155 SP9 | |
| GH02I174175 | Enhancer | 1.1 | VISTA UCNEbase ENCODE | 10.5 | +71.5 | 71459 | 2.6 | PRDM6 RFX1 POLR2A HLF IKZF1 SETDB1 TRIM28 | OLA1 ENSG00000270799 RN7SL65P | |
| GH02I174117 | Enhancer | 0.8 | Ensembl ENCODE | 9.8 | +130.1 | 130068 | 2.2 | SMARCE1 MEIS2 JUN EP300 ETS1 FOSL1 JUND SMARCA4 FOS FOSL2 | OLA1 GC02P174107 GC02P174142 |
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around OLA1 on UCSC Golden Path with GeneCards custom track
- Top Transcription factor binding sites by QIAGEN in the OLA1 gene promoter:
Regulatory Element Products
Genomic Locations for OLA1 Gene
Genomic Locations for OLA1 Gene
- chr2:174,072,447-174,248,698
- (GRCh38/hg38)
- Size:
- 176,252 bases
- Orientation:
- Minus strand
- chr2:174,937,175-175,113,426
- (GRCh37/hg19)
Genomic View for OLA1 Gene
Genes around OLA1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 2q31.1 by Ensembl
- 2q31.1 by Entrez Gene
- 2q31.1 by HGNC
OLA1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for OLA1 Gene
Proteins for OLA1 Gene
-
Protein details for OLA1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9NTK5-OLA1_HUMAN
- Recommended name:
- Obg-like ATPase 1
- Protein Accession:
- Q9NTK5
- D7EHM2
- Q5BJD7
- Q8NCI8
- Q96CU1
- Q96SV2
- Q9P1D3
- Q9UNY9
- Q9Y6G4
Protein attributes for OLA1 Gene
- Size:
- 396 amino acids
- Molecular mass:
- 44744 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Quaternary structure:
-
- Monomer.
Protein Expression for OLA1 Gene
Selected DME Specific Peptides for OLA1 Gene
- Q9NTK5:
-
- NLSEKDYIRKKNKWLIKIKEWVDK
- YHDWNDKEI
- DFKEEGSE
- RAFEDDDITHVEGSVDP
- ACDGIFHL
- EGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQ
- GKSTFFNVLT
- PAFLNVVDIAGLVKGA
- AENFPFCTI
- KGTKAPQAAGKIHTDFEKGFIMAEVMK
- PNESRVPVPD
- AVRGGDKKLKPEYDIMCKVKSWV
- RDIEIIHEEL
- GQGLGNAFLS
- NMTQSALPKIIKAG
- DPGALVIP
- LEKVAVR
Post-translational modifications for OLA1 Gene
- Ubiquitination at Lys83, isoforms=2, 3190, and isoforms=2281
Other Protein References for OLA1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
-
Custom Antibody ServicesOriGene Antibodies for OLA1
- Novus Biologicals Antibodies for OLA1
-
Abcam antibodies for OLA1
- Invitrogen Antibodies for OLA1
- GeneTex OLA1 antibody for OLA1
-
Santa Cruz Biotechnology (SCBT) Antibodies for OLA1
Protein Products
-
OriGene Purified Proteins for OLA1
- Search Origene for MassSpec and Protein Over-expression Lysates for OLA1
- Origene Custom Protein Services for OLA1
- ProSpec Recombinant Proteins for OLA1
- Search GeneTex for Proteins for OLA1
-
Abcam proteins for OLA1
Assay Products
- antibodies-online: Search results for 5 available OLA1 Elisa Kits ranked by validation data
- Compare Top OLA1 Elisa Kits
-
Quality Products:
Domains & Families for OLA1 Gene
Gene Families for OLA1 Gene
- Human Protein Atlas (HPA):
-
- Plasma proteins
- Predicted intracellular proteins
Protein Domains for OLA1 Gene
Suggested Antigen Peptide Sequences for OLA1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q9NTK5UniProtKB/Swiss-Prot:
OLA1_HUMAN :- Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily. OBG GTPase family. YchF/OLA1 subfamily.
- Family:
-
- Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily. OBG GTPase family. YchF/OLA1 subfamily.
Function for OLA1 Gene
Molecular function for OLA1 Gene
- UniProtKB/Swiss-Prot Function:
- Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.
- UniProtKB/Swiss-Prot Induction:
- Strongly down-regulated by DNA damage-inducing agents.
Phenotypes From GWAS Catalog for OLA1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005515 | protein binding | IPI | 22190034 |
| GO:0005524 | ATP binding | IEA,IDA | 17430889 |
| GO:0005525 | GTP binding | IEA | -- |
| GO:0016787 | hydrolase activity | IEA | -- |
| GO:0016887 | ATPase activity | IEA,IDA | 17430889 |
Phenotypes for OLA1 Gene
- MGI mutant phenotypes for OLA1:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for OLA1:
Animal Models for OLA1 Gene
- MGI Knock Outs for OLA1:
-
- Ola1 tm1.2Zshi
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for OLA1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for OLA1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for OLA1 gene
- Search ViGene Biosciences for OLA1
CRISPR Products
-
OriGene CRISPR knockouts for OLA1
- genomics-online: gRNA clones - Search results for available OLA1 gene related products
- Applied Biological Materials CRISPR for OLA1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for OLA1
- GenScript: Design CRISPR guide RNA sequences for OLA1
miRNA for OLA1 Gene
- miRTarBase miRNAs that target OLA1
-
- hsa-mir-877-3p (MIRT036907)
- hsa-mir-222-3p (MIRT046736)
- hsa-mir-26a-5p (MIRT050153)
- hsa-mir-4662a-5p (MIRT442353)
- hsa-mir-4762-5p (MIRT442354)
- hsa-mir-200b-5p (MIRT442355)
- hsa-mir-200a-5p (MIRT442356)
- hsa-mir-3651 (MIRT442358)
- hsa-mir-5698 (MIRT637780)
- hsa-mir-744-3p (MIRT637781)
- hsa-mir-4423-5p (MIRT637782)
- hsa-mir-6501-5p (MIRT637783)
- hsa-mir-143-5p (MIRT637784)
- hsa-mir-4430 (MIRT637785)
- hsa-mir-3652 (MIRT637786)
- hsa-mir-3622b-5p (MIRT637787)
- hsa-mir-122-5p (MIRT637788)
- hsa-mir-504-3p (MIRT637789)
- hsa-mir-3135b (MIRT637790)
- hsa-mir-6499-3p (MIRT637791)
- hsa-mir-367-5p (MIRT637792)
- hsa-mir-1267 (MIRT637793)
- hsa-mir-5693 (MIRT637794)
- hsa-mir-2681-3p (MIRT637795)
- hsa-mir-3664-5p (MIRT637796)
- hsa-mir-578 (MIRT667109)
- hsa-mir-6802-3p (MIRT667110)
- hsa-mir-627-3p (MIRT667111)
- hsa-mir-302d-5p (MIRT667112)
- hsa-mir-302b-5p (MIRT667113)
- hsa-mir-6832-3p (MIRT667114)
- hsa-mir-548c-3p (MIRT667115)
- hsa-mir-4642 (MIRT695698)
- hsa-mir-620 (MIRT695699)
- hsa-mir-1270 (MIRT695700)
- hsa-mir-584-5p (MIRT695701)
- hsa-mir-4683 (MIRT695702)
- hsa-mir-5689 (MIRT695703)
- hsa-mir-8082 (MIRT695704)
- hsa-mir-3134 (MIRT695705)
- hsa-mir-4534 (MIRT695706)
- hsa-mir-4693-3p (MIRT695707)
- hsa-mir-5585-5p (MIRT695708)
- hsa-mir-548ax (MIRT695709)
- hsa-mir-548ao-5p (MIRT695710)
- hsa-mir-758-5p (MIRT695711)
- hsa-mir-218-2-3p (MIRT695712)
- hsa-mir-4712-3p (MIRT695713)
- hsa-mir-96-3p (MIRT695714)
- hsa-mir-5583-3p (MIRT695715)
- hsa-mir-4517 (MIRT695716)
miRNA Products
- Search ViGene Biosciences for OLA1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for OLA1
- Browse OriGene Inhibitory RNA Products For OLA1
- genomics-online: shRNA clones - Search results for available OLA1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for OLA1 gene
Clone Products
- Sino Biological Human cDNA Clone for OLA1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for OLA1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for OLA1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for OLA1
- genomics-online: cdna clones - Search results for available OLA1 gene related products
- orf clones - Search results for available OLA1 gene related products
- Applied Biological Materials Clones for OLA1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for OLA1
-
ViGene Biosciences adenoviral particle packaged cDNA for OLA1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for OLA1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for OLA1 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for OLA1 Gene
Localization for OLA1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for OLA1 Gene
- Cytoplasm. Nucleus. Nucleus, nucleolus. Note=Predominantly cytoplasmic, shuttles between the nucleus and the cytoplasm. {ECO:0000255 HAMAP-Rule:MF_03167}.
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| cytoskeleton | 5 |
| cytosol | 5 |
| nucleus | 3 |
| mitochondrion | 2 |
- Cytosol (4)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005576 | extracellular region | TAS | -- |
| GO:0005634 | nucleus | IEA | -- |
| GO:0005730 | nucleolus | IEA | -- |
| GO:0005737 | cytoplasm | IEA,IDA | -- |
| GO:0005813 | centrosome | IDA | -- |
Pathways & Interactions for OLA1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Response to elevated platelet cytosolic Ca2+ |
.44
|
|
Pathways by source for OLA1 Gene
4 Reactome pathways for OLA1 Gene
Interacting Proteins for OLA1 Gene
Selected Interacting proteins:
ENSP00000284719
Q9NTK5-OLA1_HUMAN
for OLA1 Gene via
STRING
MINT
IID
UniProtKB
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0002576 | platelet degranulation | TAS | -- |
| GO:0046034 | ATP metabolic process | IDA | 17430889 |
No data available for SIGNOR curated interactions for OLA1 Gene
Drugs & Compounds for OLA1 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
Transcripts for OLA1 Gene
mRNA/cDNA for OLA1 Gene
- (3) REFSEQ mRNAs :
- (17) Additional mRNA sequences :
- (540) Selected AceView cDNA sequences:
- (9) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for OLA1
- genomics-online: gRNA clones - Search results for available OLA1 gene related products
- Applied Biological Materials CRISPR for OLA1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for OLA1
- GenScript: Design CRISPR guide RNA sequences for OLA1
miRNA Products
- Search ViGene Biosciences for OLA1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for OLA1
- Browse OriGene Inhibitory RNA Products For OLA1
- genomics-online: shRNA clones - Search results for available OLA1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for OLA1 gene
Clone Products
- Sino Biological Human cDNA Clone for OLA1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for OLA1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for OLA1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for OLA1
- genomics-online: cdna clones - Search results for available OLA1 gene related products
- orf clones - Search results for available OLA1 gene related products
- Applied Biological Materials Clones for OLA1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | · | 1e | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5a | · | 5b | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | ^ | 11a | · | 11b | ^ | 12a | · | 12b | · | 12c | ^ | 13a | · | 13b | ^ | 14 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||
| SP5: | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP9: |
Expression for OLA1 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for OLA1 Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of OLA1 Gene:
OLA1SOURCE GeneReport for Unigene cluster for OLA1 Gene:
Hs.157351mRNA Expression by UniProt/SwissProt for OLA1 Gene:
Q9NTK5-OLA1_HUMAN
Tissue specificity:
Expressed in all tissues tested but its expression is more abundant in testis, liver, lung, and brain. Overexpressed in several malignancies, including cancers of the colon, rectum, ovary, lung, stomach, and uterus.
Evidence on tissue expression from TISSUES for OLA1 Gene
- Nervous system(4.9)
- Liver(4.4)
Primer Products
-
OriGene qPCR primer pairs for OLA1
-
OriGene qPCR primer pairs and template standards for OLA1
- genomics-online: primer clones - Search results for available OLA1 gene related products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for OLA1 Gene
Orthologs for OLA1 Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | OLA1 33 34 |
|
||
| dog (Canis familiaris) |
Mammalia | OLA1 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | OLA1 33 34 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | OLA1 34 |
|
OneToOne | |
| mouse (Mus musculus) |
Mammalia | Ola1 33 16 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Ola1 33 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | OLA1 34 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | OLA1 33 34 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | OLA1 34 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | ola1 33 |
|
||
| Str.9014 33 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | MGC54033 33 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | ola1 33 34 |
|
||
| wufc66b09 33 |
|
||||
| fruit fly (Drosophila melanogaster) |
Insecta | CG1354 33 34 |
|
||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP000672 33 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | ola-1 34 |
|
OneToOne | |
| tag-210 33 |
|
||||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | OLA1 33 34 36 |
|
||
| K. lactis yeast (Kluyveromyces lactis) |
Saccharomycetes | KLLA0D03608g 33 |
|
||
| A. gosspyii yeast (Ashbya gossypii) |
Saccharomycetes | AGOS_AEL192W 33 |
|
||
| thale cress (Arabidopsis thaliana) |
eudicotyledons | AT1G30580 33 |
|
||
| soybean (Glycine max) |
eudicotyledons | Gma.2708 33 |
|
||
| Alicante grape (Vitis vinifera) |
eudicotyledons | Vvi.724 33 |
|
||
| rice (Oryza sativa) |
Liliopsida | Os08g0199300 33 |
|
||
| Os.9634 33 |
|
||||
| barley (Hordeum vulgare) |
Liliopsida | Hv.3018 33 |
|
||
| wheat (Triticum aestivum) |
Liliopsida | Ta.2982 33 |
|
||
| corn (Zea mays) |
Liliopsida | Zm.968 33 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | CSA.5782 34 |
|
OneToOne | |
| fission yeast (Schizosaccharomyces pombe) |
Schizosaccharomycetes | SPAC27E2.03c 33 |
|
||
| bread mold (Neurospora crassa) |
Ascomycetes | NCU02044 33 |
|
||
| sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.3463 33 |
|
- Species where no ortholog for OLA1 was found in the sources mined by GeneCards:
-
- Actinobacteria (Mycobacterium tuberculosis)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- beta proteobacteria (Neisseria meningitidis)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
Paralogs for OLA1 Gene
(1) SIMAP similar genes for OLA1 Gene using alignment to 4 proteins:
Pseudogenes.org Pseudogenes for OLA1 Gene
No data available for Paralogs for OLA1 Gene
Variants for OLA1 Gene
| SNP ID | Clin | Chr 02 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs193920787 | uncertain-significance, Malignant tumor of prostate | 174,082,006(-) | A/C | coding_sequence_variant, missense_variant | |
| VAR_036613 | A breast cancer sample | p.Glu168Gln | |||
| rs1000047476 | -- | 174,188,152(-) | T/C | intron_variant | |
| rs1000057129 | -- | 174,203,794(-) | G/A | intron_variant | |
| rs1000077388 | -- | 174,194,765(-) | G/A | intron_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| nsv954712 | CNV | deletion | 24416366 |
| nsv477550 | CNV | novel sequence insertion | 20440878 |
| nsv3040 | CNV | deletion | 18451855 |
| nsv1129210 | CNV | insertion | 24896259 |
| nsv1071639 | CNV | deletion | 25765185 |
| esv991222 | CNV | deletion | 20482838 |
| esv5452 | CNV | loss | 19470904 |
| esv3866 | CNV | loss | 18987735 |
| esv3593400 | CNV | loss | 21293372 |
| esv3593399 | CNV | gain | 21293372 |
| esv3560566 | CNV | deletion | 23714750 |
| esv3438023 | CNV | insertion | 20981092 |
| esv2721155 | CNV | deletion | 23290073 |
| dgv2096n106 | CNV | deletion | 24896259 |
Residual Variation Intolerance Score:
41.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
5.65;
72.75% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for OLA1 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- OLA1
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for OLA1 Gene
Disorders for OLA1 Gene
Additional Disease Information for OLA1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No disorders were found for OLA1 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for OLA1 Gene
Publications for OLA1 Gene
- Human OLA1 defines an ATPase subfamily in the Obg family of GTP-binding proteins. (PMID: 17430889) Koller-Eichhorn R … Kambach C (The Journal of biological chemistry 2007) 2 3 4 58
- Regulation of cell-matrix adhesion by OLA1, the Obg-like ATPase 1. (PMID: 24486488) Jeyabal PV … Shi ZZ (Biochemical and biophysical research communications 2014) 2 3 58
- DOC45, a novel DNA damage-regulated nucleocytoplasmic ATPase that is overexpressed in multiple human malignancies. (PMID: 20053727) Sun H … Huang Y (Molecular cancer research : MCR 2010) 3 4 58
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 44 58
- Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4 58
Products for OLA1 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for OLA1
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for OLA1
- Search Origene for MassSpec and Protein Over-expression Lysates for OLA1
- Origene Custom Protein Services for OLA1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for OLA1
- Browse OriGene Inhibitory RNA Products For OLA1
- OriGene qPCR primer pairs and template standards for OLA1
- OriGene qPCR primer pairs for OLA1
- OriGene CRISPR knockouts for OLA1
- OriGene ORF clones in human for OLA1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For OLA1
- GenScript: Next-day shipping of latest version cDNA ORF clones for OLA1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for OLA1
- GenScript Custom Assay Services for OLA1
- GenScript Custom overexpressing Cell Line Services for OLA1
- GenScript: Design CRISPR guide RNA sequences for OLA1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for OLA1
- Sino Biological Human cDNA Clone for OLA1
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for OLA1
- Novus Biologicals lysates and proteins for OLA1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for OLA1
- Abcam proteins for OLA1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for OLA1
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for OLA1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for OLA1
- VectorBuilder custom plasmid, inducible vectors for OLA1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for OLA1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for OLA1
- antibodies-online: Search results for 82 available OLA1 Antibodies ranked by validation data
- Compare Top OLA1 Antibodies
- antibodies-online: Search results for 5 available OLA1 Elisa Kits ranked by validation data
- Compare Top OLA1 Elisa Kits
- Quality Products:
- antibodies-online: Search results for 17 available OLA1 Proteins ranked by validation data
- Compare Top OLA1 Proteins
- GeneTex OLA1 antibody for OLA1
- Search GeneTex for Proteins for OLA1
- ViGene Biosciences adenoviral particle packaged cDNA for OLA1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for OLA1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for OLA1 gene
- Search ViGene Biosciences for OLA1
- Santa Cruz Biotechnology (SCBT) Antibodies for OLA1
- Search Santa Cruz Biotechnology (SCBT) for OLA1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for OLA1
- Horizon Cell Lines for OLA1
- genomics-online: cdna clones - Search results for available OLA1 gene related products
- orf clones - Search results for available OLA1 gene related products
- genomics-online: gRNA clones - Search results for available OLA1 gene related products
- genomics-online: primer clones - Search results for available OLA1 gene related products
- genomics-online: shRNA clones - Search results for available OLA1 gene related products
Sources for OLA1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew