OGT Gene (Protein Coding)

O-Linked N-Acetylglucosamine (GlcNAc) Transferase

GC0XP071534
GIFtS:
45
This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic ... See more...

Aliases for OGT Gene

Aliases for OGT Gene

  • O-Linked N-Acetylglucosamine (GlcNAc) Transferase 2 3 5
  • O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:Polypeptide-N-Acetylglucosaminyl Transferase) 2 3
  • UDP-N-Acetylglucosamine--Peptide N-Acetylglucosaminyltransferase 110 KDa Subunit 3 4
  • UDP-N-Acetylglucosamine:Polypeptide-N-Acetylglucosaminyl Transferase 2 3
  • O-Linked N-Acetylglucosamine Transferase 110 KDa Subunit 3 4
  • O-GlcNAc Transferase Subunit P110 3 4
  • Uridinediphospho-N-Acetylglucosamine:Polypeptide Beta-N-Acetylglucosaminyl Transferase 3
  • O-GlcNAc Transferase P110 Subunit 3
  • EC 2.4.1.186 52
  • EC 2.4.1.255 4
  • HINCUT-1 3
  • O-GLCNAC 3
  • EC 2.4.1 52
  • MRX106 3
  • HRNT1 3
  • OGT1 3

External Ids for OGT Gene

Previous GeneCards Identifiers for OGT Gene

  • GC0XP066927
  • GC0XP068231
  • GC0XP068986
  • GC0XP069619
  • GC0XP070535
  • GC0XP070669
  • GC0XP070752
  • GC0XP064568

Summaries for OGT Gene

Entrez Gene Summary for OGT Gene

  • This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Oct 2009]

GeneCards Summary for OGT Gene

OGT (O-Linked N-Acetylglucosamine (GlcNAc) Transferase) is a Protein Coding gene. Diseases associated with OGT include Mental Retardation, X-Linked 106 and Alzheimer Disease 19. Among its related pathways are Metabolism of proteins and Chromatin organization. Gene Ontology (GO) annotations related to this gene include identical protein binding and phosphatidylinositol-3,4,5-trisphosphate binding. An important paralog of this gene is TTC16.

UniProtKB/Swiss-Prot Summary for OGT Gene

  • Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in cytoplasmic and nuclear proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc) (PubMed:26678539, PubMed:23103939, PubMed:21240259, PubMed:21285374, PubMed:15361863). Glycosylates a large and diverse number of proteins including histone H2B, AKT1, EZH2, PFKL, KMT2E/MLL5, MAPT/TAU and HCFC1. Can regulate their cellular processes via cross-talk between glycosylation and phosphorylation or by affecting proteolytic processing (PubMed:21285374). Probably by glycosylating KMT2E/MLL5, stabilizes KMT2E/MLL5 by preventing its ubiquitination (PubMed:26678539). Involved in insulin resistance in muscle and adipocyte cells via glycosylating insulin signaling components and inhibiting the 'Thr-308' phosphorylation of AKT1, enhancing IRS1 phosphorylation and attenuating insulin signaling (By similarity). Involved in glycolysis regulation by mediating glycosylation of 6-phosphofructokinase PFKL, inhibiting its activity (PubMed:22923583). Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. Plays a key role in chromatin structure by mediating O-GlcNAcylation of 'Ser-112' of histone H2B: recruited to CpG-rich transcription start sites of active genes via its interaction with TET proteins (TET1, TET2 or TET3) (PubMed:22121020, PubMed:23353889). As part of the NSL complex indirectly involved in acetylation of nucleosomal histone H4 on several lysine residues (PubMed:20018852). O-GlcNAcylation of 'Ser-75' of EZH2 increases its stability, and facilitating the formation of H3K27me3 by the PRC2/EED-EZH2 complex (PubMed:24474760). Regulates circadian oscillation of the clock genes and glucose homeostasis in the liver. Stabilizes clock proteins ARNTL/BMAL1 and CLOCK through O-glycosylation, which prevents their ubiquitination and subsequent degradation. Promotes the CLOCK-ARNTL/BMAL1-mediated transcription of genes in the negative loop of the circadian clock such as PER1/2 and CRY1/2 (PubMed:12150998, PubMed:19451179, PubMed:20018868, PubMed:20200153, PubMed:21285374, PubMed:15361863). O-glycosylates HCFC1 and regulates its proteolytic processing and transcriptional activity (PubMed:21285374, PubMed:28584052, PubMed:28302723). Regulates mitochondrial motility in neurons by mediating glycosylation of TRAK1 (By similarity). Glycosylates HOXA1 (By similarity).
  • [Isoform 2]: the mitochondrial isoform (mOGT) is cytotoxic and triggers apoptosis in several cell types including INS1, an insulinoma cell line.

Gene Wiki entry for OGT Gene

Additional gene information for OGT Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for OGT Gene

Genomics for OGT Gene

GeneHancer (GH) Regulatory Elements for OGT Gene

Promoters and enhancers for OGT Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around OGT on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for OGT

Top Transcription factor binding sites by QIAGEN in the OGT gene promoter:
  • AP-1
  • CUTL1

Genomic Locations for OGT Gene

Genomic Locations for OGT Gene
chrX:71,533,062-71,575,897
(GRCh38/hg38)
Size:
42,836 bases
Orientation:
Plus strand
chrX:70,752,912-70,795,747
(GRCh37/hg19)
Size:
42,836 bases
Orientation:
Plus strand

Genomic View for OGT Gene

Genes around OGT on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
OGT Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for OGT Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for OGT Gene

Proteins for OGT Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for OGT Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O15294-OGT1_HUMAN
    Recommended name:
    UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
    Protein Accession:
    O15294
    Secondary Accessions:
    • Q7Z3K0
    • Q8WWM8
    • Q96CC1
    • Q9UG57

    Protein attributes for OGT Gene

    Size:
    1046 amino acids
    Molecular mass:
    116925 Da
    Quaternary structure:
    • Monomer; may exist in different oligomerization states in cells (PubMed:21240259). Homotrimer, oligomerizes via TPR repeats 6 and 7. Trimerization is not necessary for activity in vitro, however it increases affinity for UDP-GlcNAc (By similarity). Component of a THAP1/THAP3-HCFC1-OGT complex (PubMed:20200153). Component of the NSL complex at least composed of MOF/KAT8, KANSL1, KANSL2, KANSL3, MCRS1, PHF20, OGT1/OGT, WDR5 and HCFC1 (PubMed:20018852). Interacts directly with HCFC1; the interaction O-glycosylates HCFC1, regulates its proteolytic processing and transcriptional activity and, in turn, stabilizes OGT in the nucleus (PubMed:12670868, PubMed:20200153, PubMed:21285374, PubMed:23353889). Interacts (via TPRs 1-6) with SIN3A; the interaction mediates transcriptional repression in parallel with histone deacetylase (PubMed:12150998). Interacts (via TPR 5-6) with TET1, TET2 and TET3 (PubMed:23353889, PubMed:23222540). Interacts (via TPR repeats 6 and 7) with ATXN10 (By similarity). Interacts with histone H2B (PubMed:22121020). Interacts with ARNTL/BMAL1. Found in a complex composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1. Interacts with SINHCAF (By similarity). Component of a complex composed of KMT2E/MLL5 (isoform 3), OGT (isoform 1) and USP7; the complex stabilizes KMT2E/MLL5, preventing KMT2E/MLL5 ubiquitination and proteosomal-mediated degradation (PubMed:26678539). Isoform 1 interacts (via TRP repeats) with isoform 3 KMT2E/MLL5 (via N-terminus) (PubMed:26678539, PubMed:23629655). Isoform 1 interacts with USP7 (PubMed:26678539). Interacts with TRAK1; this interaction is not required for glycosylation of TRAK1 by this protein. Found in a complex with KIF5B, RHOT1, RHOT2 and TRAK1 (PubMed:24995978). Interacts (via TPR repeats domain) with HOXA1; the interaction takes place mainly in the nucleus (By similarity).
    • (Microbial infection) Interacts with human T-cell leukemia virus 1/HTLV-1 protein Tax; this interaction increases Tax interacting partner CREB1 O-GlcNAcylation.

    Three dimensional structures from OCA and Proteopedia for OGT Gene

    Alternative splice isoforms for OGT Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for OGT Gene

Protein Expression for OGT Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for OGT Gene

O15294:
  • CYLKAIETQP
  • NNLANIKREQG
  • LWLLRFP
  • PTFADAYSNMGNTLKEM
  • YINLAAALV
  • EKLAYMPHTFFIGDHA
  • DLSQIPCNGKAA
  • LDTPLCNGHTTG
  • LQPHFPDAYCNLANALKEKGSV
  • NHAVVHGNLACVYYEQGLIDLAIDTY
  • RLPSVHPHHSMLYPLSH
  • NPDLYCVRSDLGNLLKA
  • GTPMVTMP
  • PEFAAAHSNLAS
  • NGYTKGARNE
  • GYVSSDFGNHP
  • RAIQINPAFADAHSNLASIHKD
  • NTGVLLL
  • EVFCYALS
  • FAVAWSNLGCVFN
  • TALKLKPDFPDAYCNLAHC
  • NILKRVPNS
  • HYKEAIRI
  • NLGNVYK
  • LCPTHADS
  • NTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGL
  • VTLDPNFLDAYINLGNVLK
  • CNFNQLYKIDPSTL
  • FMDYIITD
  • QDGIHIL

Post-translational modifications for OGT Gene

  • Ubiquitinated, leading to its proteasomal degradation.
  • Phosphorylation on Ser-3 or Ser-4 by GSK3-beta positively regulates its activity.
  • Glycosylation at Ser3 and Ser4
  • Ubiquitination at Lys16, Lys83, Lys100, Lys168, Lys337, Lys644, Lys724, Lys742, Lys971, and Lys1010
  • Modification sites at PhosphoSitePlus

Other Protein References for OGT Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for OGT Gene

Gene Families for OGT Gene

HGNC:
Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Potential drug targets
  • Predicted intracellular proteins

Protein Domains for OGT Gene

InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for OGT Gene

GenScript: Design optimal peptide antigens:
  • O-linked N-acetylglucosamine transferase 110 kDa subunit (OGT1_HUMAN)
  • O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase), isoform CRA_a (Q548W1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

O15294

UniProtKB/Swiss-Prot:

OGT1_HUMAN :
  • The TPR repeat domain is required for substrate binding and oligomerization.
  • Belongs to the glycosyltransferase 41 family. O-GlcNAc transferase subfamily.
Domain:
  • The TPR repeat domain is required for substrate binding and oligomerization.
Family:
  • Belongs to the glycosyltransferase 41 family. O-GlcNAc transferase subfamily.
genes like me logo Genes that share domains with OGT: view

Function for OGT Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line

Molecular function for OGT Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in cytoplasmic and nuclear proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc) (PubMed:26678539, PubMed:23103939, PubMed:21240259, PubMed:21285374, PubMed:15361863). Glycosylates a large and diverse number of proteins including histone H2B, AKT1, EZH2, PFKL, KMT2E/MLL5, MAPT/TAU and HCFC1. Can regulate their cellular processes via cross-talk between glycosylation and phosphorylation or by affecting proteolytic processing (PubMed:21285374). Probably by glycosylating KMT2E/MLL5, stabilizes KMT2E/MLL5 by preventing its ubiquitination (PubMed:26678539). Involved in insulin resistance in muscle and adipocyte cells via glycosylating insulin signaling components and inhibiting the 'Thr-308' phosphorylation of AKT1, enhancing IRS1 phosphorylation and attenuating insulin signaling (By similarity). Involved in glycolysis regulation by mediating glycosylation of 6-phosphofructokinase PFKL, inhibiting its activity (PubMed:22923583). Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. Plays a key role in chromatin structure by mediating O-GlcNAcylation of 'Ser-112' of histone H2B: recruited to CpG-rich transcription start sites of active genes via its interaction with TET proteins (TET1, TET2 or TET3) (PubMed:22121020, PubMed:23353889). As part of the NSL complex indirectly involved in acetylation of nucleosomal histone H4 on several lysine residues (PubMed:20018852). O-GlcNAcylation of 'Ser-75' of EZH2 increases its stability, and facilitating the formation of H3K27me3 by the PRC2/EED-EZH2 complex (PubMed:24474760). Regulates circadian oscillation of the clock genes and glucose homeostasis in the liver. Stabilizes clock proteins ARNTL/BMAL1 and CLOCK through O-glycosylation, which prevents their ubiquitination and subsequent degradation. Promotes the CLOCK-ARNTL/BMAL1-mediated transcription of genes in the negative loop of the circadian clock such as PER1/2 and CRY1/2 (PubMed:12150998, PubMed:19451179, PubMed:20018868, PubMed:20200153, PubMed:21285374, PubMed:15361863). O-glycosylates HCFC1 and regulates its proteolytic processing and transcriptional activity (PubMed:21285374, PubMed:28584052, PubMed:28302723). Regulates mitochondrial motility in neurons by mediating glycosylation of TRAK1 (By similarity). Glycosylates HOXA1 (By similarity).
UniProtKB/Swiss-Prot Function:
[Isoform 2]: the mitochondrial isoform (mOGT) is cytotoxic and triggers apoptosis in several cell types including INS1, an insulinoma cell line.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl)-L-seryl-[protein] + H(+) + UDP; Xref=Rhea:RHEA:48904, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:12251, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:57705, ChEBI:CHEBI:58223, ChEBI:CHEBI:90838; EC=2.4.1.255; Evidence={ECO:0000269 PubMed:15361863, ECO:0000269 PubMed:21240259, ECO:0000269 PubMed:21285374, ECO:0000269 PubMed:23103939, ECO:0000305 PubMed:26678539};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=L-threonyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl)-L-threonyl-[protein] + H(+) + UDP; Xref=Rhea:RHEA:48908, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:12252, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:57705, ChEBI:CHEBI:58223, ChEBI:CHEBI:90840; EC=2.4.1.255; Evidence={ECO:0000269 PubMed:15361863, ECO:0000269 PubMed:21240259, ECO:0000269 PubMed:21285374, ECO:0000305 PubMed:26678539};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Subject to product inhibition by UDP.
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=1.8 uM for UDP-N-acetyl-D-glucosamine {ECO:0000269 PubMed:21240259};
UniProtKB/Swiss-Prot Induction:
Induction of the nucleocytoplasmic OGT (ncOGT) isoform in the liver on glucose deprivation is mediated by the decreased hexosamine biosynthesis pathway (HBP) flux.
GENATLAS Biochemistry:
O-linked N-acetylglucosamine (GlcNAc) transferase,putative part of a glucose-responsive pathway implicated in the pathogenesis of diabetes mellitus

Enzyme Numbers (IUBMB) for OGT Gene

Phenotypes From GWAS Catalog for OGT Gene

Gene Ontology (GO) - Molecular Function for OGT Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI,IEA 12150998
GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding IDA 18288188
GO:0008289 lipid binding IEA --
GO:0008375 acetylglucosaminyltransferase activity TAS 9083068
GO:0016262 protein N-acetylglucosaminyltransferase activity IMP,IBA 26678539
genes like me logo Genes that share ontologies with OGT: view
genes like me logo Genes that share phenotypes with OGT: view

Human Phenotype Ontology for OGT Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Model Products

miRNA for OGT Gene

miRTarBase miRNAs that target OGT

Clone Products

  • Addgene plasmids for OGT

No data available for Animal Models , Transcription Factor Targets and HOMER Transcription for OGT Gene

Localization for OGT Gene

Subcellular locations from UniProtKB/Swiss-Prot for OGT Gene

Nucleus. Cytoplasm. Note=Predominantly localizes to the nucleus. {ECO:0000269 PubMed:26678539}.
[Isoform 2]: Mitochondrion. Membrane. Note=Associates with the mitochondrial inner membrane. {ECO:0000269 PubMed:20824293}.
[Isoform 3]: Cytoplasm. Nucleus. Cell membrane. Mitochondrion membrane. Cell projection. Note=Mostly in the nucleus. Retained in the nucleus via interaction with HCFC1 (PubMed:21285374). After insulin induction, translocated from the nucleus to the cell membrane via phosphatidylinositide binding. Colocalizes with AKT1 at the plasma membrane. TRAK1 recruits this protein to mitochondria. In the absence of TRAK1, localizes in cytosol and nucleus (By similarity). {ECO:0000250 UniProtKB:P56558, ECO:0000269 PubMed:21285374}.
[Isoform 4]: Cytoplasm. Nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for OGT gene
Compartment Confidence
plasma membrane 5
nucleus 5
cytosol 5
mitochondrion 4
cytoskeleton 3
extracellular 2
endoplasmic reticulum 2
lysosome 2
golgi apparatus 2
peroxisome 1
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoplasm (3)
  • Plasma membrane (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for OGT Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000123 histone acetyltransferase complex IDA 20018852
GO:0005634 nucleus IDA,TAS 21285374
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IEA --
GO:0005739 mitochondrion IEA --
genes like me logo Genes that share ontologies with OGT: view

Pathways & Interactions for OGT Gene

genes like me logo Genes that share pathways with OGT: view

Pathways by source for OGT Gene

1 Cell Signaling Technology pathway for OGT Gene

UniProtKB/Swiss-Prot O15294-OGT1_HUMAN

  • Pathway: Protein modification; protein glycosylation.

SIGNOR curated interactions for OGT Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for OGT Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006110 regulation of glycolytic process IDA 22923583
GO:0006111 regulation of gluconeogenesis ISS --
GO:0006325 chromatin organization IEA --
GO:0006357 regulation of transcription by RNA polymerase II IMP 26678539
GO:0006486 protein glycosylation IEA --
genes like me logo Genes that share ontologies with OGT: view

Drugs & Compounds for OGT Gene

Products:

  1. Drug

(7) Drugs for OGT Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Calcium Approved Nutra 7884
Manganese Approved Nutra 51
Uridine 5'-diphosphate Experimental Pharma 0

(7) Additional Compounds for OGT Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Lactosamine
  • 2-amino-2-Deoxy-4-O-beta-D-galactopyranosyl-D-glucose
  • 2-amino-2-Deoxy-4-O-beta-delta-galactopyranosyl-delta-glucose
  • beta-D-Galactopyranosyl-(1->4)-2-amino-2-deoxy-D-glucose
  • beta-D-Galactopyranosyl-(1->4)-D-glucosamine
  • beta-delta-Galactopyranosyl-(1->4)-2-amino-2-deoxy-delta-glucose
 13000-25-4
Uridine diphosphate-N-acetylgalactosamine
  • UDP-N-Acetyl-D-galactosamine
  • UDP-N-Acetyl-delta-galactosamine
  • UDP-N-Acetylgalactosamine
  • Uridine 5'-diphospho-N-acetylgalactosamine
  • Uridine diphosphate-N-acetyl-D-galactosamine
 7277-98-7
Uridine diphosphate-N-acetylglucosamine
  • (2R,3R,4R,5S,6R)-3-(acetylamino)-4,5-Dihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate (non-preferred name)
  • UDP-GlcNAc
  • UDP-N-Acetyl-D-glucosamine
  • UDP-N-Acetylglucosamine
  • URIDINE-diphosphATE-N-acetylglucosamine
 528-04-1
genes like me logo Genes that share compounds with OGT: view

Transcripts for OGT Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone

mRNA/cDNA for OGT Gene

3 REFSEQ mRNAs :
15 NCBI additional mRNA sequence :
11 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Clone Products

  • Addgene plasmids for OGT

Alternative Splicing Database (ASD) splice patterns (SP) for OGT Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b · 3c ^ 4 ^ 5 ^ 6a · 6b · 6c · 6d ^ 7a · 7b · 7c ^ 8 ^ 9 ^ 10 ^ 11 ^ 12a · 12b ^ 13 ^ 14 ^ 15 ^
SP1: - - - - - - -
SP2: - - - - - - - -
SP3:
SP4: -
SP5: - - - - - - - - - - - - - -
SP6: - - -
SP7:
SP8: - -
SP9: - - - -
SP10: - - - -
SP11: -
SP12:
SP13:

ExUns: 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21a · 21b · 21c ^ 22a · 22b ^ 23 ^ 24a · 24b · 24c ^ 25 ^ 26
SP1: - -
SP2: - -
SP3: - -
SP4: - -
SP5:
SP6:
SP7: -
SP8:
SP9:
SP10:
SP11:
SP12: -
SP13:

Relevant External Links for OGT Gene

GeneLoc Exon Structure for
OGT

Expression for OGT Gene

Products:

  1. Primer
  2. Gene Expression Assay

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for OGT Gene

mRNA expression in normal human tissues for OGT Gene
mRNA expression by GTEx for OGT GenemRNA expression by BioGPS for OGT Gene

Protein differential expression in normal tissues from HIPED for OGT Gene

This gene is overexpressed in Lymph node (14.0) and Frontal cortex (7.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for OGT Gene



Protein tissue co-expression partners for OGT Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for OGT

SOURCE GeneReport for Unigene cluster for OGT Gene:

Hs.405410

mRNA Expression by UniProt/SwissProt for OGT Gene:

O15294-OGT1_HUMAN
Tissue specificity: Highly expressed in pancreas and to a lesser extent in skeletal muscle, heart, brain and placenta. Present in trace amounts in lung and liver.

Evidence on tissue expression from TISSUES for OGT Gene

  • Nervous system(4.9)
  • Liver(4.6)
  • Intestine(4.5)
  • Pancreas(4.5)
  • Lung(3)
  • Heart(2.9)
  • Muscle(2.9)
  • Blood(2.7)
  • Kidney(2.4)
  • Skin(2.3)
genes like me logo Genes that share expression patterns with OGT: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for OGT Gene

Orthologs for OGT Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for OGT Gene

Organism Taxonomy Gene Similarity Type Details
oppossum
(Monodelphis domestica)
 Mammalia OGT 31
  • 98 (a)
 OneToOne
dog
(Canis familiaris)
 Mammalia OGT 31 30
  • 95.25 (n)
 OneToOne
cow
(Bos Taurus)
 Mammalia OGT 31 30
  • 94.95 (n)
 OneToOne
mouse
(Mus musculus)
 Mammalia Ogt 17 31 30
  • 92.45 (n)
rat
(Rattus norvegicus)
 Mammalia Ogt 30
  • 92.25 (n)
chimpanzee
(Pan troglodytes)
 Mammalia OGT 30
  • 90.98 (n)
platypus
(Ornithorhynchus anatinus)
 Mammalia -- 31
  • 13 (a)
 ManyToMany
chicken
(Gallus gallus)
 Aves OGT 31 30
  • 83.99 (n)
 OneToOne
lizard
(Anolis carolinensis)
 Reptilia OGT 31
  • 97 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia ogt 30
  • 80.39 (n)
African clawed frog
(Xenopus laevis)
 Amphibia Xl.25936 30
zebrafish
(Danio rerio)
 Actinopterygii ogt.2 31
  • 85 (a)
 OneToMany
ogt.1 31 30
  • 78.2 (n)
 OneToMany
wufr75f09 30
rainbow trout
(Oncorhynchus mykiss)
 Actinopterygii Omy.10249 30
fruit fly
(Drosophila melanogaster)
 Insecta sxc 31 30
  • 67.43 (n)
 OneToOne
Ogt 32
  • 58 (a)
African malaria mosquito
(Anopheles gambiae)
 Insecta AgaP_AGAP006254 30
  • 66.43 (n)
worm
(Caenorhabditis elegans)
 Secernentea K04G7.3 32
  • 68 (a)
ogt-1 31 30
  • 63.54 (n)
 OneToOne
thale cress
(Arabidopsis thaliana)
 eudicotyledons SEC 30
  • 52.33 (n)
rice
(Oryza sativa)
 Liliopsida Os.45968 30
wheat
(Triticum aestivum)
 Liliopsida Ta.28845 30
sea squirt
(Ciona savignyi)
 Ascidiacea -- 31
  • 76 (a)
 OneToOne
Cin.15222 30
sea squirt
(Ciona intestinalis)
 Ascidiacea Cin.15222 30
Species where no ortholog for OGT was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for OGT Gene

ENSEMBL:
Gene Tree for OGT (if available)
TreeFam:
Gene Tree for OGT (if available)
Aminode:
Evolutionary constrained regions (ECRs) for OGT: view image

Paralogs for OGT Gene

Paralogs for OGT Gene

genes like me logo Genes that share paralogs with OGT: view

Variants for OGT Gene

Products:

  1. SNP Genotyping and Copy Number Assay

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for OGT Gene

SNP ID Clinical significance and condition Chr 0X pos Variation AA Info Type
638525 Uncertain Significance: MENTAL RETARDATION, X-LINKED 106 71,537,959(+) C/T MISSENSE_VARIANT
689775 Likely Pathogenic: MENTAL RETARDATION, X-LINKED 106 71,567,705(+) C/T MISSENSE_VARIANT
691611 Pathogenic: MENTAL RETARDATION, X-LINKED 106 71,561,865(+) A/T MISSENSE_VARIANT
720641 Benign: not provided 71,557,066(+) A/C SYNONYMOUS_VARIANT
745173 Likely Benign: not provided 71,555,296(+) A/G MISSENSE_VARIANT

Additional dbSNP identifiers (rs#s) for OGT Gene

Structural Variations from Database of Genomic Variants (DGV) for OGT Gene

Variant ID Type Subtype PubMed ID
esv1584074 OTHER inversion 17803354
esv2740213 CNV deletion 23290073
esv33082 CNV loss 17666407
esv3574043 CNV loss 25503493

Variation tolerance for OGT Gene

Residual Variation Intolerance Score: 5.62% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.24; 5.33% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for OGT Gene

Human Gene Mutation Database (HGMD)
OGT
SNPedia medical, phenotypic, and genealogical associations of SNPs for
OGT

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for OGT Gene

Disorders for OGT Gene

MalaCards: The human disease database

(7) MalaCards diseases for OGT Gene - From: UniProtKB/Swiss-Prot, OMIM, ClinVar, GTR, DISEASES, Novoseek, and GeneCards

- elite association - COSMIC cancer census association via MalaCards
Search OGT in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

OGT1_HUMAN
  • Note=Regulation of OGT activity and altered O-GlcNAcylations are implicated in diabetes and Alzheimer disease. O-GlcNAcylation of AKT1 affects insulin signaling and, possibly diabetes. Reduced O-GlcNAcylations and resulting increased phosphorylations of MAPT/TAU are observed in Alzheimer disease (AD) brain cerebrum.
  • Mental retardation, X-linked 106 (MRX106) [MIM:300997]: A form of mental retardation, a disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. Intellectual deficiency is the only primary symptom of non-syndromic X-linked mental retardation, while syndromic mental retardation presents with associated physical, neurological and/or psychiatric manifestations. {ECO:0000269 PubMed:26273451, ECO:0000269 PubMed:28302723, ECO:0000269 PubMed:28584052}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Additional Disease Information for OGT

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with OGT: view

No data available for Genatlas for OGT Gene

Publications for OGT Gene

  1. The THAP-zinc finger protein THAP1 associates with coactivator HCF-1 and O-GlcNAc transferase: a link between DYT6 and DYT3 dystonias. (PMID: 20200153) Mazars R … Girard JP (The Journal of biological chemistry 2010) 3 4 23 54
  2. Recruitment of O-GlcNAc transferase to promoters by corepressor mSin3A: coupling protein O-GlcNAcylation to transcriptional repression. (PMID: 12150998) Yang X … Kudlow JE (Cell 2002) 3 4 23 54
  3. Human O-GlcNAc transferase (OGT): genomic structure, analysis of splice variants, fine mapping in Xq13.1. (PMID: 11773972) Nolte D … Müller U (Mammalian genome : official journal of the International Mammalian Genome Society 2002) 3 4 23 54
  4. O-Linked GlcNAc transferase is a conserved nucleocytoplasmic protein containing tetratricopeptide repeats. (PMID: 9083068) Lubas WA … Hanover JA (The Journal of biological chemistry 1997) 2 3 4 54
  5. Mutations in N-acetylglucosamine (O-GlcNAc) transferase in patients with X-linked intellectual disability. (PMID: 28584052) Willems AP … Lefeber DJ (The Journal of biological chemistry 2017) 3 4 54

ExternalLinks

View latest publications for OGT gene in Mastermind

Products for OGT Gene

  • Addgene plasmids for OGT