Free for academic non-profit institutions. Other users need a Commercial license

OGT Gene(Protein Coding)

O-Linked N-Acetylglucosamine (GlcNAc) Transferase

GCID:
GC0XP071534
GIFtS:
53
Genes Participants
UDN Logo

Aliases for OGT Gene

Aliases for OGT Gene

  • O-Linked N-Acetylglucosamine (GlcNAc) Transferase 2 3 5
  • O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:Polypeptide-N-Acetylglucosaminyl Transferase) 2 3
  • UDP-N-Acetylglucosamine:Polypeptide-N-Acetylglucosaminyl Transferase 2 3
  • O-Linked N-Acetylglucosamine Transferase 110 KDa Subunit 3 4
  • O-GlcNAc Transferase Subunit P110 3 4
  • Uridinediphospho-N-Acetylglucosamine:Polypeptide Beta-N-Acetylglucosaminyl Transferase 3
  • UDP-N-Acetylglucosamine--Peptide N-Acetylglucosaminyltransferase 110 KDa Subunit 3
  • O-GlcNAc Transferase P110 Subunit 3
  • EC 2.4.1.186 56
  • EC 2.4.1.255 4
  • HINCUT-1 3
  • O-GLCNAC 3
  • EC 2.4.1 56
  • MRX106 3
  • HRNT1 3
  • OGT1 3

External Ids for OGT Gene

Previous GeneCards Identifiers for OGT Gene

  • GC0XP066927
  • GC0XP068231
  • GC0XP068986
  • GC0XP069619
  • GC0XP070535
  • GC0XP070669
  • GC0XP070752
  • GC0XP064568

Summaries for OGT Gene

Entrez Gene Summary for OGT Gene

  • This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Oct 2009]

GeneCards Summary for OGT Gene

OGT (O-Linked N-Acetylglucosamine (GlcNAc) Transferase) is a Protein Coding gene. Diseases associated with OGT include Mental Retardation, X-Linked 106 and Adams-Oliver Syndrome. Among its related pathways are Ectoderm Differentiation and Metabolism of proteins. Gene Ontology (GO) annotations related to this gene include identical protein binding and phosphatidylinositol-3,4,5-trisphosphate binding. An important paralog of this gene is TMTC1.

UniProtKB/Swiss-Prot for OGT Gene

  • Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in cytoplasmic and nuclear proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Glycosylates a large and diverse number of proteins including histone H2B, AKT1, EZH2, PFKL, KMT2E/MLL5, MAPT/TAU and HCFC1. Can regulate their cellular processes via cross-talk between glycosylation and phosphorylation or by affecting proteolytic processing. Involved in insulin resistance in muscle and adipocyte cells via glycosylating insulin signaling components and inhibiting the Thr-308 phosphorylation of AKT1, enhancing IRS1 phosphorylation and attenuating insulin signaling. Involved in glycolysis regulation by mediating glycosylation of 6-phosphofructokinase PFKL, inhibiting its activity (PubMed:22923583). Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. Plays a key role in chromatin structure by mediating O-GlcNAcylation of Ser-112 of histone H2B: recruited to CpG-rich transcription start sites of active genes via its interaction with TET proteins (TET1, TET2 or TET3) (PubMed:22121020, PubMed:23353889). As part of the NSL complex indirectly involved in acetylation of nucleosomal histone H4 on several lysine residues (PubMed:20018852). O-GlcNAcylation of Ser-75 of EZH2 increases its stability, and facilitating the formation of H3K27me3 by the PRC2/EED-EZH2 complex (PubMed:24474760). Regulates circadian oscillation of the clock genes and glucose homeostasis in the liver. Stabilizes clock proteins ARNTL/BMAL1 and CLOCK through O-glycosylation, which prevents their ubiquitination and subsequent degradation. Promotes the CLOCK-ARNTL/BMAL1-mediated transcription of genes in the negative loop of the circadian clock such as PER1/2 and CRY1/2 (PubMed:12150998, PubMed:18288188, PubMed:19377461, PubMed:19451179, PubMed:20018868, PubMed:20200153, PubMed:21285374, PubMed:15361863). O-glycosylates HCFC1 and regulates its proteolytic processing and transcriptional activity (PubMed:21285374, PubMed:28584052, PubMed:28302723).

  • Isoform 2: the mitochondrial isoform (mOGT) is cytotoxic and triggers apoptosis in several cell types including INS1, an insulinoma cell line.

Gene Wiki entry for OGT Gene

Additional gene information for OGT Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for OGT Gene

Genomics for OGT Gene

Products:

  1. Regulatory Element

GeneHancer (GH) Regulatory Elements for OGT Gene

Promoters and enhancers for OGT Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH0XI071530 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 568.8 +0.7 683 5.7 FEZF1 DMAP1 IRF4 YY1 ZNF213 E2F8 ZNF143 SP3 NFYC ZC3H11A OGT TAF1 NONO MED12 ERCC6L GCNA LOC100420758 ENSG00000229601 RPS26P11 ZMYM3
GH0XI071181 Enhancer 1.8 FANTOM5 Ensembl ENCODE dbSUPER 66.2 -350.2 -350191 3.5 PKNOX1 FOXA2 ARNT ZFP64 ARID4B SIN3A FEZF1 DMAP1 YY1 POLR2B TAF1 NONO MED12 OGT LOC100420758 ENSG00000229601 P2RY4 ARR3 RPS26P11 RTL5
GH0XI072271 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 42.3 +741.8 741843 6 HDGF SMAD1 ARNT ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 POLR2B RPS4X TAF1 NONO LOC100420758 ERCC6L OGT RTL5 LOC392489 ENSG00000229601 TOMM20P4
GH0XI071250 Promoter/Enhancer 2 EPDnew Ensembl ENCODE 17.4 -279.3 -279275 6.1 HDGF PKNOX1 ARNT NEUROD1 SIN3A FEZF1 ZNF2 YY1 ZNF766 ZNF213 ZMYM3 LOC105373247 TAF1 LOC100420758 MED12 NONO OGT ERCC6L ARR3 ENSG00000229601
GH0XI071282 Promoter/Enhancer 2 EPDnew Ensembl ENCODE 12.7 -248.8 -248753 4.2 PKNOX1 SMAD1 ARNT SIN3A FEZF1 DMAP1 ZNF2 YY1 POLR2B ZNF213 NONO MED12 ERCC6L OGT ENSG00000229601 TAF1 LOC392489 RPS26P11 ITGB1BP2
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around OGT on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the OGT gene promoter:

Genomic Locations for OGT Gene

Genomic Locations for OGT Gene
chrX:71,533,062-71,575,897
(GRCh38/hg38)
Size:
42,836 bases
Orientation:
Plus strand
chrX:70,752,912-70,795,747
(GRCh37/hg19)

Genomic View for OGT Gene

Genes around OGT on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
OGT Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for OGT Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for OGT Gene

Proteins for OGT Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for OGT Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O15294-OGT1_HUMAN
    Recommended name:
    UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
    Protein Accession:
    O15294
    Secondary Accessions:
    • Q7Z3K0
    • Q8WWM8
    • Q96CC1
    • Q9UG57

    Protein attributes for OGT Gene

    Size:
    1046 amino acids
    Molecular mass:
    116925 Da
    Quaternary structure:
    • Heterotrimer; consists of one 78 kDa subunit and two 110 kDa subunits dimerized via TPR repeats 6 and 7. Interacts (via TPR repeats 6 and 7) with ATXN10 (By similarity). Component of the MLL5-L complex, at least composed of KMT2E/MLL5, STK38, PPP1CA, PPP1CB, HCFC1, PPP1CC and ACTB. Component of a THAP1/THAP3-HCFC1-OGT complex. Component of the NSL complex at least composed of MOF/KAT8, KANSL1, KANSL2, KANSL3, MCRS1, PHF20, OGT1/OGT, WDR5 and HCFC1. Interacts directly with HCFC1; the interaction O-glycosylates HCFC1, regulates its proteolytic processing and transcriptional activity and, in turn, stabilizes OGT in the nucleus. Interacts (via TPRs 1-6) with SIN3A; the interaction mediates transcriptional repression in parallel with histone deacetylase. Interacts (via TPR 5-6) with TET1, TET2 and TET3. Interacts with ARNTL/BMAL1 (By similarity). Found in a complex composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1. Interacts with SINHCAF (By similarity).

    Three dimensional structures from OCA and Proteopedia for OGT Gene

    Alternative splice isoforms for OGT Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for OGT Gene

Protein Expression for OGT Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for OGT Gene

O15294:
  • CYLKAIETQP
  • NNLANIKREQG
  • LWLLRFP
  • PTFADAYSNMGNTLKEM
  • YINLAAALV
  • EKLAYMPHTFFIGDHA
  • DLSQIPCNGKAA
  • LDTPLCNGHTTG
  • LQPHFPDAYCNLANALKEKGSV
  • NHAVVHGNLACVYYEQGLIDLAIDTY
  • RLPSVHPHHSMLYPLSH
  • NPDLYCVRSDLGNLLKA
  • GTPMVTMP
  • PEFAAAHSNLAS
  • NGYTKGARNE
  • GYVSSDFGNHP
  • RAIQINPAFADAHSNLASIHKD
  • NTGVLLL
  • EVFCYALS
  • FAVAWSNLGCVFN
  • TALKLKPDFPDAYCNLAHC
  • NILKRVPNS
  • HYKEAIRI
  • NLGNVYK
  • LCPTHADS
  • NTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGL
  • VTLDPNFLDAYINLGNVLK
  • CNFNQLYKIDPSTL
  • FMDYIITD
  • QDGIHIL

Post-translational modifications for OGT Gene

  • Phosphorylation on Ser-3 or Ser-4 by GSK3-beta positively regulates its activity.
  • Ubiquitinated, leading to its proteasomal degradation.
  • Ubiquitination at Lys16, isoforms=383, Lys100, Lys168, isoforms=3, 2337, isoforms=3, 2, 4644, isoforms=3, 2, 4724, isoforms=3, 2, 4742, Lys971, and Lys1010
  • Glycosylation at Ser3 and Ser4
  • Modification sites at PhosphoSitePlus

Other Protein References for OGT Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for OGT Gene

Gene Families for OGT Gene

HGNC:
Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Potential drug targets
  • Predicted intracellular proteins

Protein Domains for OGT Gene

InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for OGT Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

O15294

UniProtKB/Swiss-Prot:

OGT1_HUMAN :
  • The TPR repeat domain is required for substrate binding and oligomerization.
  • Belongs to the glycosyltransferase 41 family. O-GlcNAc transferase subfamily.
Domain:
  • The TPR repeat domain is required for substrate binding and oligomerization.
Family:
  • Belongs to the glycosyltransferase 41 family. O-GlcNAc transferase subfamily.
genes like me logo Genes that share domains with OGT: view

Function for OGT Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line

Molecular function for OGT Gene

GENATLAS Biochemistry:
O-linked N-acetylglucosamine (GlcNAc) transferase,putative part of a glucose-responsive pathway implicated in the pathogenesis of diabetes mellitus
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=1.8 uM for UDP-N-acetyl-D-glucosamine {ECO:0000269 PubMed:21240259};
UniProtKB/Swiss-Prot CatalyticActivity:
UDP-N-acetyl-alpha-D-glucosamine + [protein]-L-serine = UDP + [protein]-3-O-(N-acetyl-beta-D-glucosaminyl)-L-serine.
UniProtKB/Swiss-Prot CatalyticActivity:
UDP-N-acetyl-alpha-D-glucosamine + [protein]-L-threonine = UDP + [protein]-3-O-(N-acetyl-beta-D-glucosaminyl)-L-threonine.
UniProtKB/Swiss-Prot EnzymeRegulation:
Subject to product inhibition by UDP.
UniProtKB/Swiss-Prot Function:
Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in cytoplasmic and nuclear proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Glycosylates a large and diverse number of proteins including histone H2B, AKT1, EZH2, PFKL, KMT2E/MLL5, MAPT/TAU and HCFC1. Can regulate their cellular processes via cross-talk between glycosylation and phosphorylation or by affecting proteolytic processing. Involved in insulin resistance in muscle and adipocyte cells via glycosylating insulin signaling components and inhibiting the Thr-308 phosphorylation of AKT1, enhancing IRS1 phosphorylation and attenuating insulin signaling. Involved in glycolysis regulation by mediating glycosylation of 6-phosphofructokinase PFKL, inhibiting its activity (PubMed:22923583). Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. Plays a key role in chromatin structure by mediating O-GlcNAcylation of Ser-112 of histone H2B: recruited to CpG-rich transcription start sites of active genes via its interaction with TET proteins (TET1, TET2 or TET3) (PubMed:22121020, PubMed:23353889). As part of the NSL complex indirectly involved in acetylation of nucleosomal histone H4 on several lysine residues (PubMed:20018852). O-GlcNAcylation of Ser-75 of EZH2 increases its stability, and facilitating the formation of H3K27me3 by the PRC2/EED-EZH2 complex (PubMed:24474760). Regulates circadian oscillation of the clock genes and glucose homeostasis in the liver. Stabilizes clock proteins ARNTL/BMAL1 and CLOCK through O-glycosylation, which prevents their ubiquitination and subsequent degradation. Promotes the CLOCK-ARNTL/BMAL1-mediated transcription of genes in the negative loop of the circadian clock such as PER1/2 and CRY1/2 (PubMed:12150998, PubMed:18288188, PubMed:19377461, PubMed:19451179, PubMed:20018868, PubMed:20200153, PubMed:21285374, PubMed:15361863). O-glycosylates HCFC1 and regulates its proteolytic processing and transcriptional activity (PubMed:21285374, PubMed:28584052, PubMed:28302723).
UniProtKB/Swiss-Prot Function:
Isoform 2: the mitochondrial isoform (mOGT) is cytotoxic and triggers apoptosis in several cell types including INS1, an insulinoma cell line.
UniProtKB/Swiss-Prot Induction:
Induction of the nucleocytoplasmic OGT (ncOGT) isoform in the liver on glucose deprivation is mediated by the decreased hexosamine biosynthesis pathway (HBP) flux.

Enzyme Numbers (IUBMB) for OGT Gene

Gene Ontology (GO) - Molecular Function for OGT Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 12150998
GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding IDA 18288188
GO:0008289 lipid binding IEA --
GO:0008375 acetylglucosaminyltransferase activity TAS 9083068
GO:0016262 protein N-acetylglucosaminyltransferase activity IDA 21240259
genes like me logo Genes that share ontologies with OGT: view
genes like me logo Genes that share phenotypes with OGT: view

Animal Model Products

miRNA for OGT Gene

miRTarBase miRNAs that target OGT

Clone Products

No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for OGT Gene

Localization for OGT Gene

Subcellular locations from UniProtKB/Swiss-Prot for OGT Gene

Isoform 2: Mitochondrion. Membrane. Note=Associates with the mitochondrial inner membrane.
Isoform 3: Cytoplasm. Nucleus. Cell membrane. Note=Mostly in the nucleus. Retained in the nucleus via interaction with HCFC1. After insulin induction, translocated from the nucleus to the cell membrane via phophatidylinisotide binding. Colocalizes with AKT1 at the plasma membrane.
Isoform 4: Cytoplasm. Nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for OGT gene
Compartment Confidence
plasma membrane 5
mitochondrion 5
nucleus 5
cytosol 5
cytoskeleton 3
extracellular 2
peroxisome 1
endoplasmic reticulum 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoplasm (3)
  • Plasma membrane (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for OGT Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000123 histone acetyltransferase complex IDA 20018852
GO:0005634 nucleus IDA,TAS 21285374
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IEA --
GO:0005739 mitochondrion IEA --
genes like me logo Genes that share ontologies with OGT: view

Pathways & Interactions for OGT Gene

genes like me logo Genes that share pathways with OGT: view

Pathways by source for OGT Gene

1 Cell Signaling Technology pathway for OGT Gene

UniProtKB/Swiss-Prot O15294-OGT1_HUMAN

  • Pathway: Protein modification; protein glycosylation.

SIGNOR curated interactions for OGT Gene

Is activated by:

Gene Ontology (GO) - Biological Process for OGT Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006110 regulation of glycolytic process IDA 22923583
GO:0006486 protein glycosylation IEA --
GO:0006493 protein O-linked glycosylation IMP,TAS 23353889
GO:0006915 apoptotic process IEA,IDA 20824293
GO:0007165 signal transduction TAS 9083067
genes like me logo Genes that share ontologies with OGT: view

Drugs & Compounds for OGT Gene

Products:

  1. Drug

(8) Drugs for OGT Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
calcium Approved Nutra 0
Manganese Approved Nutra 37
Uridine-5'-Diphosphate Experimental Pharma 0

(6) Additional Compounds for OGT Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Lactosamine
  • 2-Amino-2-deoxy-4-O-beta-D-galactopyranosyl-D-glucose
  • 2-Amino-2-deoxy-4-O-beta-delta-galactopyranosyl-delta-glucose
  • beta-D-Galactopyranosyl-(1->4)-2-amino-2-deoxy-D-glucose
  • beta-D-Galactopyranosyl-(1->4)-D-glucosamine
  • beta-delta-Galactopyranosyl-(1->4)-2-amino-2-deoxy-delta-glucose
 13000-25-4
Uridine diphosphate-N-acetylgalactosamine
  • UDP-N-Acetyl-D-galactosamine
  • UDP-N-Acetyl-delta-galactosamine
  • UDP-N-Acetylgalactosamine
  • Uridine 5'-diphospho-N-acetylgalactosamine
  • Uridine diphosphate-N-acetyl-D-galactosamine
 7277-98-7
Uridine diphosphate-N-acetylglucosamine
  • N-[2-[[[5-[(2,4-Dioxo-1H-pyrimidin-1-yl)]-3,4-dihydroxy-tetrahydrofuran-2-yl]methoxy-hydroxy-phosphinoyl]oxy-hydroxy-phosphinoyl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]acetamide
  • UDP-a-D-N-Acetylglucosamine
  • UDP-Acetyl-D-glucosamine
  • UDP-Acetyl-delta-glucosamine
  • UDP-Acetylglucosamine
 528-04-1
genes like me logo Genes that share compounds with OGT: view

Transcripts for OGT Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone

mRNA/cDNA for OGT Gene

(5) REFSEQ mRNAs :
(13) Additional mRNA sequences :
(422) Selected AceView cDNA sequences:
(11) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for OGT Gene

O-linked N-acetylglucosamine (GlcNAc) transferase:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for OGT Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b · 3c ^ 4 ^ 5 ^ 6a · 6b · 6c · 6d ^ 7a · 7b · 7c ^ 8 ^ 9 ^ 10 ^ 11 ^ 12a · 12b ^ 13 ^ 14 ^ 15 ^
SP1: - - - - - - -
SP2: - - - - - - - -
SP3:
SP4: -
SP5: - - - - - - - - - - - - - -
SP6: - - -
SP7:
SP8: - -
SP9: - - - -
SP10: - - - -
SP11: -
SP12:
SP13:

ExUns: 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21a · 21b · 21c ^ 22a · 22b ^ 23 ^ 24a · 24b · 24c ^ 25 ^ 26
SP1: - -
SP2: - -
SP3: - -
SP4: - -
SP5:
SP6:
SP7: -
SP8:
SP9:
SP10:
SP11:
SP12: -
SP13:

Relevant External Links for OGT Gene

GeneLoc Exon Structure for
OGT
ECgene alternative splicing isoforms for
OGT

Expression for OGT Gene

Products:

  1. Primer
  2. Gene Expression Assay

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for OGT Gene

mRNA expression in normal human tissues for OGT Gene
mRNA expression by BioGPS for OGT GenemRNA expression by GTEx for OGT Gene

Protein differential expression in normal tissues from HIPED for OGT Gene

This gene is overexpressed in Lymph node (14.0) and Frontal cortex (7.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for OGT Gene



Protein tissue co-expression partners for OGT Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of OGT Gene:

OGT

SOURCE GeneReport for Unigene cluster for OGT Gene:

Hs.405410

mRNA Expression by UniProt/SwissProt for OGT Gene:

O15294-OGT1_HUMAN
Tissue specificity: Highly expressed in pancreas and to a lesser extent in skeletal muscle, heart, brain and placenta. Present in trace amounts in lung and liver.

Evidence on tissue expression from TISSUES for OGT Gene

  • Nervous system(4.9)
  • Liver(4.6)
  • Intestine(4.5)
  • Pancreas(4.5)
  • Lung(3)
  • Heart(2.9)
  • Muscle(2.9)
  • Blood(2.7)
  • Kidney(2.4)
  • Skin(2.3)
genes like me logo Genes that share expression patterns with OGT: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for OGT Gene

Orthologs for OGT Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for OGT Gene

Organism Taxonomy Gene Similarity Type Details
oppossum
(Monodelphis domestica)
 Mammalia OGT 34
  • 98 (a)
 OneToOne
dog
(Canis familiaris)
 Mammalia OGT 33 34
  • 95.25 (n)
cow
(Bos Taurus)
 Mammalia OGT 33 34
  • 94.95 (n)
mouse
(Mus musculus)
 Mammalia Ogt 33 16 34
  • 92.45 (n)
rat
(Rattus norvegicus)
 Mammalia Ogt 33
  • 92.25 (n)
chimpanzee
(Pan troglodytes)
 Mammalia OGT 33
  • 90.98 (n)
platypus
(Ornithorhynchus anatinus)
 Mammalia -- 34
  • 13 (a)
 ManyToMany
chicken
(Gallus gallus)
 Aves OGT 34 33
  • 83.99 (n)
 OneToOne
lizard
(Anolis carolinensis)
 Reptilia OGT 34
  • 97 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia ogt 33
  • 80.39 (n)
African clawed frog
(Xenopus laevis)
 Amphibia Xl.25936 33
zebrafish
(Danio rerio)
 Actinopterygii ogt.2 34
  • 85 (a)
 OneToMany
ogt.1 33 34
  • 78.2 (n)
wufr75f09 33
rainbow trout
(Oncorhynchus mykiss)
 Actinopterygii Omy.10249 33
fruit fly
(Drosophila melanogaster)
 Insecta sxc 34 33
  • 67.43 (n)
 OneToOne
Ogt 35
  • 58 (a)
African malaria mosquito
(Anopheles gambiae)
 Insecta AgaP_AGAP006254 33
  • 66.43 (n)
worm
(Caenorhabditis elegans)
 Secernentea K04G7.3 35
  • 68 (a)
ogt-1 33 34
  • 63.54 (n)
thale cress
(Arabidopsis thaliana)
 eudicotyledons SEC 33
  • 52.33 (n)
rice
(Oryza sativa)
 Liliopsida Os.45968 33
wheat
(Triticum aestivum)
 Liliopsida Ta.28845 33
sea squirt
(Ciona savignyi)
 Ascidiacea -- 34
  • 76 (a)
 OneToOne
sea squirt
(Ciona intestinalis)
 Ascidiacea Cin.15222 33
Species where no ortholog for OGT was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for OGT Gene

ENSEMBL:
Gene Tree for OGT (if available)
TreeFam:
Gene Tree for OGT (if available)

Paralogs for OGT Gene

Paralogs for OGT Gene

genes like me logo Genes that share paralogs with OGT: view

Variants for OGT Gene

Products:

  1. SNP Genotyping and Copy Number Assay

Sequence variations from dbSNP and Humsavar for OGT Gene

SNP ID Clin Chr 0X pos Variation AA Info Type
rs797044898 uncertain-significance, Inborn genetic diseases 71,555,236(+) G/A coding_sequence_variant, intron_variant, missense_variant
rs943295842 pathogenic, MENTAL RETARDATION, X-LINKED 106 71,544,561(+) T/C/G intron_variant
VAR_074019 Mental retardation, X-linked 106 (MRX106) [MIM:300997] p.Ala319Thr
VAR_079183 Mental retardation, X-linked 106 (MRX106) [MIM:300997] p.Arg284Pro
VAR_079254 Mental retardation, X-linked 106 (MRX106) [MIM:300997] p.Leu254Phe

Structural Variations from Database of Genomic Variants (DGV) for OGT Gene

Variant ID Type Subtype PubMed ID
esv1584074 OTHER inversion 17803354
esv2740213 CNV deletion 23290073
esv33082 CNV loss 17666407
esv3574043 CNV loss 25503493

Variation tolerance for OGT Gene

Residual Variation Intolerance Score: 5.62% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.24; 5.33% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for OGT Gene

Human Gene Mutation Database (HGMD)
OGT
SNPedia medical, phenotypic, and genealogical associations of SNPs for
OGT

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for OGT Gene

Disorders for OGT Gene

MalaCards: The human disease database

(6) MalaCards diseases for OGT Gene - From: HGMD, OMIM, ClinVar, Swiss-Prot, DISEASES, Novoseek, and GeneCards

- elite association - COSMIC cancer census association via MalaCards
Search OGT in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

OGT1_HUMAN
  • Mental retardation, X-linked 106 (MRX106) [MIM:300997]: A form of mental retardation, a disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. Intellectual deficiency is the only primary symptom of non-syndromic X-linked mental retardation, while syndromic mental retardation presents with associated physical, neurological and/or psychiatric manifestations. {ECO:0000269 PubMed:26273451, ECO:0000269 PubMed:28302723, ECO:0000269 PubMed:28584052}. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Note=Regulation of OGT activity and altered O-GlcNAcylations are implicated in diabetes and Alzheimer disease. O-GlcNAcylation of AKT1 affects insulin signaling and, possibly diabetes. Reduced O-GlcNAcylations and resulting increased phosphorylations of MAPT/TAU are observed in Alzheimer disease (AD) brain cerebrum.

Additional Disease Information for OGT

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with OGT: view

No data available for Genatlas for OGT Gene

Publications for OGT Gene

  1. The THAP-zinc finger protein THAP1 associates with coactivator HCF-1 and O-GlcNAc transferase: a link between DYT6 and DYT3 dystonias. (PMID: 20200153) Mazars R … Girard JP (The Journal of biological chemistry 2010) 3 4 22 58
  2. Phosphoinositide signalling links O-GlcNAc transferase to insulin resistance. (PMID: 18288188) Yang X … Evans RM (Nature 2008) 3 4 22 58
  3. Human O-GlcNAc transferase (OGT): genomic structure, analysis of splice variants, fine mapping in Xq13.1. (PMID: 11773972) Nolte D … Müller U (Mammalian genome : official journal of the International Mammalian Genome Society 2002) 3 4 22 58
  4. Recruitment of O-GlcNAc transferase to promoters by corepressor mSin3A: coupling protein O-GlcNAcylation to transcriptional repression. (PMID: 12150998) Yang X … Kudlow JE (Cell 2002) 3 4 22 58
  5. O-Linked GlcNAc transferase is a conserved nucleocytoplasmic protein containing tetratricopeptide repeats. (PMID: 9083068) Lubas WA … Hanover JA (The Journal of biological chemistry 1997) 2 3 4 58

Products for OGT Gene

Sources for OGT Gene

Content
Loading form....