This gene encodes one subunit of the 2-oxoglutarate dehydrogenase complex. This complex catalyzes the overall conversion of 2-oxoglutarate (alpha-ketoglutarate) to succinyl-CoA and CO(2) during the Krebs cycle. The protein is located in the mitochondrial matrix and uses thiamine pyrophosphate as a cofactor. A congenital deficiency in 2-oxoglutarate dehydrogenase activity is bel... See more...

Aliases for OGDH Gene

Aliases for OGDH Gene

  • Oxoglutarate Dehydrogenase 2 3 5
  • OGDC-E1 2 3 4
  • Oxoglutarate (Alpha-Ketoglutarate) Dehydrogenase (Lipoamide) 2 3
  • 2-Oxoglutarate Dehydrogenase Complex Component E1 3 4
  • 2-Oxoglutarate Dehydrogenase, Mitochondrial 3 4
  • EC 1.2.4.2 4 51
  • OGDH2 2 3
  • KGD1 2 3
  • E1k 2 3
  • Oxoglutarate Dehydrogenase (Succinyl-Transferring) 3
  • Alpha-Ketoglutarate Dehydrogenase 4
  • Testicular Tissue Protein Li 131 3
  • Oxoglutarate Decarboxylase 3
  • AKGDH 3
  • OGDC 3
  • OGDH 5

External Ids for OGDH Gene

Previous GeneCards Identifiers for OGDH Gene

  • GC07P044292
  • GC07P044387
  • GC07P044419
  • GC07P044612
  • GC07P044646

Summaries for OGDH Gene

Entrez Gene Summary for OGDH Gene

  • This gene encodes one subunit of the 2-oxoglutarate dehydrogenase complex. This complex catalyzes the overall conversion of 2-oxoglutarate (alpha-ketoglutarate) to succinyl-CoA and CO(2) during the Krebs cycle. The protein is located in the mitochondrial matrix and uses thiamine pyrophosphate as a cofactor. A congenital deficiency in 2-oxoglutarate dehydrogenase activity is believed to lead to hypotonia, metabolic acidosis, and hyperlactatemia. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Sep 2009]

GeneCards Summary for OGDH Gene

OGDH (Oxoglutarate Dehydrogenase) is a Protein Coding gene. Diseases associated with OGDH include Alpha-Ketoglutarate Dehydrogenase Deficiency and Wernicke-Korsakoff Syndrome. Among its related pathways are Citrate cycle (TCA cycle) and Valproic Acid Pathway, Pharmacodynamics. Gene Ontology (GO) annotations related to this gene include chaperone binding and oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor. An important paralog of this gene is OGDHL.

UniProtKB/Swiss-Prot Summary for OGDH Gene

  • 2-oxoglutarate dehydrogenase (E1) component of the 2-oxoglutarate dehydrogenase complex, which mediates the decarboxylation of alpha-ketoglutarate (PubMed:24495017). The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2) (PubMed:24495017). The 2-oxoglutarate dehydrogenase complex is mainly active in the mitochondrion (PubMed:29211711). A fraction of the 2-oxoglutarate dehydrogenase complex also localizes in the nucleus and is required for lysine succinylation of histones: associates with KAT2A on chromatin and provides succinyl-CoA to histone succinyltransferase KAT2A (PubMed:29211711).

Gene Wiki entry for OGDH Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for OGDH Gene

Genomics for OGDH Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for OGDH Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around OGDH on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for OGDH

Top Transcription factor binding sites by QIAGEN in the OGDH gene promoter:
  • ATF6
  • c-Myc
  • E4BP4
  • Egr-4
  • Lmo2
  • Max1
  • p53
  • Pax-6
  • SREBP-1a
  • SREBP-1b

Genomic Locations for OGDH Gene

Genomic Locations for OGDH Gene
chr7:44,606,572-44,709,066
(GRCh38/hg38)
Size:
102,495 bases
Orientation:
Plus strand
chr7:44,646,121-44,748,669
(GRCh37/hg19)
Size:
102,549 bases
Orientation:
Plus strand

Genomic View for OGDH Gene

Genes around OGDH on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
OGDH Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for OGDH Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for OGDH Gene

Proteins for OGDH Gene

  • Protein details for OGDH Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q02218-ODO1_HUMAN
    Recommended name:
    2-oxoglutarate dehydrogenase, mitochondrial
    Protein Accession:
    Q02218
    Secondary Accessions:
    • B4E2U9
    • D3DVL0
    • E9PBM1
    • Q96DD3
    • Q9UDX0

    Protein attributes for OGDH Gene

    Size:
    1023 amino acids
    Molecular mass:
    115935 Da
    Cofactor:
    Name=thiamine diphosphate; Xref=ChEBI:CHEBI:58937;
    Quaternary structure:
    • The 2-oxoglutarate dehydrogenase complex is composed of OGDH (2-oxoglutarate dehydrogenase; E1), DLST (dihydrolipoamide succinyltransferase; E2) and DLD (dihydrolipoamide dehydrogenase; E3). It contains multiple copies of the three enzymatic components (E1, E2 and E3). In the nucleus, the 2-oxoglutarate dehydrogenase complex associates with KAT2A (PubMed:29211711).
    SequenceCaution:
    • Sequence=BAA01393.1; Type=Frameshift; Evidence={ECO:0000305}; Sequence=BAA06836.1; Type=Frameshift; Evidence={ECO:0000305};
    Miscellaneous:
    • [Isoform 2]: Probably insensitive to calcium.

    Three dimensional structures from OCA and Proteopedia for OGDH Gene

    Alternative splice isoforms for OGDH Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for OGDH Gene

Selected DME Specific Peptides for OGDH Gene

Q02218:
  • RLSGQDV
  • GQAKWVR
  • KSLLRHP
  • VVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVN
  • GPEHSSAR
  • IHGGLSRILK
  • GKTKAEQFY
  • GMPHRGRLNVLANV
  • EPFLSGT
  • LPTTTFIGG
  • NEEKRTLLARLVRSTRFEEFL
  • HLAVQSLIRAYQIRGHHVAQLDPLGILDADLDS
  • EQLSPFP
  • LREIIRRLE
  • GTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPI
  • QLYDCNW
  • AYCQHIGVEFMFINDLEQCQWIRQKFE
  • SNYVEEMY
  • EGSGDVKYHLG
  • GYYDYVK
  • RKWSSEKRFGLEGCEV
  • FQRVIPE
  • RRQILLPFRKPLI
  • TPKSLLR
  • RTVDWALAEYM
  • LSLVANPSHLE
  • VLGFELG
  • DLVCYRR
  • RGTFSHRH
  • KLRPLTASQT
  • KLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLD
  • VLQKYAE
  • LTHIGNVASSVPVE
  • FCTGKVYY
  • GRDPAAAPATGN
  • DEPMFTQPLMY
  • SVHKSWD
  • ERFLQMC

Post-translational modifications for OGDH Gene

  • Ubiquitination at Lys74 and Lys534
  • Modification sites at PhosphoSitePlus

Domains & Families for OGDH Gene

Gene Families for OGDH Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • FDA approved drug targets
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for OGDH Gene

InterPro:
Blocks:
  • Transketolase, central region
ProtoNet:

Suggested Antigen Peptide Sequences for OGDH Gene

GenScript: Design optimal peptide antigens:
  • OGDH protein (A2VCT2_HUMAN)
  • OGDH protein (A2VCT3_HUMAN)
  • Oxoglutarate (Alpha-ketoglutarate) dehydrogenase (A5XEI0_HUMAN)
  • Oxoglutarate (Alpha-ketoglutarate) dehydrogenase (A5XEI1_HUMAN)
  • Alpha-ketoglutarate dehydrogenase (ODO1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q02218

UniProtKB/Swiss-Prot:

ODO1_HUMAN :
  • Belongs to the alpha-ketoglutarate dehydrogenase family.
Family:
  • Belongs to the alpha-ketoglutarate dehydrogenase family.
genes like me logo Genes that share domains with OGDH: view

Function for OGDH Gene

Molecular function for OGDH Gene

UniProtKB/Swiss-Prot Function:
2-oxoglutarate dehydrogenase (E1) component of the 2-oxoglutarate dehydrogenase complex, which mediates the decarboxylation of alpha-ketoglutarate (PubMed:24495017). The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2) (PubMed:24495017). The 2-oxoglutarate dehydrogenase complex is mainly active in the mitochondrion (PubMed:29211711). A fraction of the 2-oxoglutarate dehydrogenase complex also localizes in the nucleus and is required for lysine succinylation of histones: associates with KAT2A on chromatin and provides succinyl-CoA to histone succinyltransferase KAT2A (PubMed:29211711).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=2-oxoglutarate + [dihydrolipoyllysine-residue succinyltransferase]-(R)-N(6)-lipoyl-L-lysine + H(+) = [dihydrolipoyllysine-residue succinyltransferase]-(R)-N(6)-(S(8)-succinyldihydrolipoyl)-L-lysine + CO2; Xref=Rhea:RHEA:12188, Rhea:RHEA-COMP:10483, Rhea:RHEA-COMP:10484, ChEBI:CHEBI:15378, ChEBI:CHEBI:16526, ChEBI:CHEBI:16810, ChEBI:CHEBI:83099, ChEBI:CHEBI:83120; EC=1.2.4.2; Evidence={ECO:0000269|PubMed:24495017, ECO:0000269|PubMed:29211711};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Calcium ions and ADP stimulate, whereas ATP and NADH reduce catalytic activity.
GENATLAS Biochemistry:
2-oxoglutarate lipoamide 2 oxidoreductase (decarboxylating and acceptor-succinylating,component E1 of the 2-oxoglutarate complex,mitochondrial matrix

Enzyme Numbers (IUBMB) for OGDH Gene

Phenotypes From GWAS Catalog for OGDH Gene

Gene Ontology (GO) - Molecular Function for OGDH Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004591 oxoglutarate dehydrogenase (succinyl-transferring) activity IEA,ISS --
GO:0016491 oxidoreductase activity IEA --
GO:0016624 oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor IEA --
GO:0030976 thiamine pyrophosphate binding IEA,IDA 24495017
GO:0031072 heat shock protein binding IEA --
genes like me logo Genes that share ontologies with OGDH: view
genes like me logo Genes that share phenotypes with OGDH: view

Human Phenotype Ontology for OGDH Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for OGDH Gene

MGI Knock Outs for OGDH:
  • Ogdh Ogdh<tm1e(KOMP)Wtsi>

Animal Model Products

CRISPR Products

miRNA for OGDH Gene

miRTarBase miRNAs that target OGDH

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for OGDH

Clone Products

  • Addgene plasmids for OGDH

No data available for Transcription Factor Targets and HOMER Transcription for OGDH Gene

Localization for OGDH Gene

Subcellular locations from UniProtKB/Swiss-Prot for OGDH Gene

Mitochondrion matrix. Nucleus. Note=Mainly localizes in the mitochondrion. A small fraction localizes to the nucleus, where the 2-oxoglutarate dehydrogenase complex is required for histone succinylation. {ECO:0000269 PubMed:29211711}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for OGDH gene
Compartment Confidence
mitochondrion 5
nucleus 5
extracellular 2
cytosol 2
plasma membrane 1
cytoskeleton 1
peroxisome 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for OGDH Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,IDA 29211711
GO:0005739 mitochondrion IDA 29211711
GO:0005759 mitochondrial matrix TAS --
GO:0031966 mitochondrial membrane ISS --
GO:0045252 oxoglutarate dehydrogenase complex IBA,IDA 29211711
genes like me logo Genes that share ontologies with OGDH: view

Pathways & Interactions for OGDH Gene

genes like me logo Genes that share pathways with OGDH: view

Gene Ontology (GO) - Biological Process for OGDH Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006091 generation of precursor metabolites and energy ISS --
GO:0006096 glycolytic process IEA --
GO:0006099 tricarboxylic acid cycle IEA,TAS --
GO:0006103 2-oxoglutarate metabolic process IDA 24495017
GO:0006104 succinyl-CoA metabolic process IDA 24495017
genes like me logo Genes that share ontologies with OGDH: view

No data available for SIGNOR curated interactions for OGDH Gene

Drugs & Compounds for OGDH Gene

(29) Drugs for OGDH Gene - From: DrugBank, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
NADH Approved Nutra Target 0
Valproic acid Approved, Investigational Pharma Target, inhibitor HDAC1 inhibitor, Histone deacetylase (HDAC)inhibitors 377
Xanthinol Approved, Withdrawn Pharma Target, cofactor 0
Carbon dioxide Approved, Investigational, Vet_approved Pharma 0
2-Ketobutyric acid Experimental Pharma 0

(42) Additional Compounds for OGDH Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Lipoamide
  • 1,2-Dithiolane-3-pentanamide
  • alpha-Lipoic acid amide
  • Lipoacin
  • Thioctamide
  • Thioctic acid amide
940-69-2
(S)-Succinyldihydrolipoamide
  • S-Succinyl-dihydrolipoamide
  • S-Succinyldihydrolipoamide
2-(a-Hydroxyethyl)thiamine diphosphate
  • 2-(alpha-Hydroxyethyl)thiamine diphosphate
  • 2-Hydroxyethyl-THPP
  • 2-(a-Hydroxyethyl)thiamine diphosphoric acid
  • 2-(alpha-Hydroxyethyl)thiamine diphosphoric acid
  • 2-(α-hydroxyethyl)thiamine diphosphate
10055-47-7
3-Carboxy-1-hydroxypropylthiamine diphosphate
  • 2-(3-Carboxy-1-hydroxypropyl)thiamine diphosphate
  • 3-Carboxy-1-hydroxypropyl-THPP
  • 2-(3-Carboxy-1-hydroxypropyl)thiamine diphosphoric acid
  • 3-Carboxy-1-hydroxypropylthiamine diphosphoric acid
  • 3-[(4-amino-2-Methylpyrimidin-5-yl)methyl]-2-(3-carboxy-1-hydroxypropyl)-5-(2-diphosphoethyl)-4-methyl-1,3-thiazol-3-ium
Glutaryl-coa
  • Glutaryl-coenzyme A
103192-48-9
genes like me logo Genes that share compounds with OGDH: view

Transcripts for OGDH Gene

mRNA/cDNA for OGDH Gene

4 REFSEQ mRNAs :
21 NCBI additional mRNA sequence :
10 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for OGDH

Clone Products

  • Addgene plasmids for OGDH

Alternative Splicing Database (ASD) splice patterns (SP) for OGDH Gene

ExUns: 1a · 1b · 1c · 1d · 1e · 1f ^ 2a · 2b · 2c ^ 3 ^ 4a · 4b · 4c · 4d ^ 5a · 5b · 5c · 5d · 5e ^ 6 ^ 7 ^ 8 ^ 9a · 9b · 9c ^ 10a ·
SP1: - -
SP2: - - - - - - -
SP3: - - - - - - - -
SP4: - - - - - - -
SP5:
SP6: - - - - - - - - - - - - - - -
SP7: - - - - - - - - - - - - - - - - - - - -
SP8: - - - - - - - - - - - - - - -
SP9: - - - - -
SP10: - - - - - - - - - - - - - - - - - - -
SP11: - - -
SP12: -
SP13:
SP14:
SP15: - - -
SP16: -
SP17:

ExUns: 10b · 10c · 10d ^ 11a · 11b · 11c · 11d ^ 12 ^ 13a · 13b · 13c ^ 14 ^ 15 ^ 16a · 16b ^ 17 ^ 18a · 18b · 18c ^ 19 ^ 20a · 20b ^ 21 ^ 22 ^ 23 ^ 24 ^
SP1: - - -
SP2:
SP3:
SP4:
SP5: -
SP6:
SP7: - - - - - - - - - - - - - - - - -
SP8: - - -
SP9:
SP10: - - - - - - - - - -
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:

ExUns: 25 ^ 26 ^ 27
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:

Relevant External Links for OGDH Gene

GeneLoc Exon Structure for
OGDH

Expression for OGDH Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for OGDH Gene

mRNA differential expression in normal tissues according to GTEx for OGDH Gene

This gene is overexpressed in Heart - Left Ventricle (x6.9) and Muscle - Skeletal (x5.6).

Protein differential expression in normal tissues from HIPED for OGDH Gene

This gene is overexpressed in Heart (14.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for OGDH Gene



Protein tissue co-expression partners for OGDH Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for OGDH

SOURCE GeneReport for Unigene cluster for OGDH Gene:

Hs.488181

Evidence on tissue expression from TISSUES for OGDH Gene

  • Nervous system(4.9)
  • Muscle(4.8)
  • Liver(4.7)
  • Heart(4.5)
  • Bone marrow(4.3)
  • Lung(3.8)
  • Pancreas(3.5)
  • Kidney(3.4)
  • Skin(3)
  • Eye(2.7)
  • Intestine(2.6)
  • Stomach(2.5)
  • Thyroid gland(2.3)
  • Blood(2.3)
  • Adrenal gland(2.1)
  • Lymph node(2.1)

Phenotype-based relationships between genes and organs from Gene ORGANizer for OGDH Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • digestive
  • nervous
  • skeletal muscle
  • skeleton
Regions:
Head and neck:
  • brain
  • cerebellum
  • cerebrospinal fluid
  • head
  • meninges
  • mouth
  • salivary gland
  • skull
genes like me logo Genes that share expression patterns with OGDH: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA Expression by UniProt/SwissProt for OGDH Gene

Orthologs for OGDH Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for OGDH Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia OGDH 30 31
  • 99.64 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia -- 31
  • 97 (a)
OneToMany
-- 31
  • 92 (a)
OneToMany
OGDH 30
  • 89.46 (n)
Oppossum
(Monodelphis domestica)
Mammalia OGDH 31
  • 93 (a)
OneToOne
Cow
(Bos Taurus)
Mammalia OGDH 30 31
  • 90.16 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Ogdh 30
  • 89.44 (n)
Mouse
(Mus musculus)
Mammalia Ogdh 30 17 31
  • 89.21 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia OGDH 31
  • 87 (a)
OneToOne
Chicken
(Gallus gallus)
Aves OGDH 30 31
  • 82.78 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia OGDH 31
  • 91 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia ogdh 30
  • 78.39 (n)
Str.8708 30
African clawed frog
(Xenopus laevis)
Amphibia MGC68800 30
Zebrafish
(Danio rerio)
Actinopterygii ogdhb 31
  • 84 (a)
OneToMany
ogdha 30 31
  • 77.1 (n)
OneToMany
-- 30
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.12508 30
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP006366 30
  • 64.78 (n)
Fruit Fly
(Drosophila melanogaster)
Insecta Nc73EF 30 31
  • 62.41 (n)
ManyToMany
CG11661 32
  • 61 (a)
CG32316-ORFB 32
  • 53 (a)
CG18170 32
  • 51 (a)
CG33791 31
  • 42 (a)
ManyToMany
Worm
(Caenorhabditis elegans)
Secernentea ogdh-1 30 31
  • 57.97 (n)
OneToMany
T22B11.5 32
  • 57 (a)
A. gosspyii yeast
(Eremothecium gossypii)
Saccharomycetes AGOS_AER374C 30
  • 53.96 (n)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes KGD1 30 31 33
  • 51.38 (n)
OneToMany
K. Lactis Yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0F04477g 30
  • 50.83 (n)
Thale Cress
(Arabidopsis thaliana)
eudicotyledons AT3G55410 30
  • 54.56 (n)
Alicante grape
(Vitis vinifera)
eudicotyledons Vvi.10739 30
Rice
(Oryza sativa)
Liliopsida Os07g0695800 30
  • 57.81 (n)
Os.11872 30
Corn
(Zea mays)
Liliopsida Zm.6807 30
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.7934 31
  • 64 (a)
OneToMany
Bread mold
(Neurospora crassa)
Ascomycetes NCU05425 30
  • 55.61 (n)
Fission Yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes SPBC3H7.03c 30
  • 52.36 (n)
Species where no ortholog for OGDH was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for OGDH Gene

ENSEMBL:
Gene Tree for OGDH (if available)
TreeFam:
Gene Tree for OGDH (if available)
Aminode:
Evolutionary constrained regions (ECRs) for OGDH: view image

Paralogs for OGDH Gene

Paralogs for OGDH Gene

(2) SIMAP similar genes for OGDH Gene using alignment to 10 proteins:

  • ODO1_HUMAN
  • A2VCT2_HUMAN
  • A2VCT3_HUMAN
  • A5XEI0_HUMAN
  • A5XEI1_HUMAN
  • C9J4G7_HUMAN
  • E9PCR7_HUMAN
  • E9PDF2_HUMAN
  • E9PFG7_HUMAN
  • F5H801_HUMAN
genes like me logo Genes that share paralogs with OGDH: view

Variants for OGDH Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for OGDH Gene

SNP ID Clinical significance and condition Chr 07 pos Variation AA Info Type
653756 Uncertain Significance: Oxoglutaricaciduria 44,707,368(+) G/A MISSENSE_VARIANT
665016 Uncertain Significance: Oxoglutaricaciduria 44,696,486(+) C/T MISSENSE_VARIANT
707974 Likely Benign: not provided 44,694,441(+) C/T SYNONYMOUS_VARIANT
709484 Likely Benign: not provided 44,696,535(+) G/A SYNONYMOUS_VARIANT
714150 Likely Benign: not provided 44,707,239(+) C/A SYNONYMOUS_VARIANT

Additional dbSNP identifiers (rs#s) for OGDH Gene

Structural Variations from Database of Genomic Variants (DGV) for OGDH Gene

Variant ID Type Subtype PubMed ID
dgv1906e212 CNV loss 25503493
dgv3787e59 CNV tandem duplication 20981092
esv3376101 CNV duplication 20981092
nsv1078986 CNV insertion 25765185
nsv1117459 CNV tandem duplication 24896259
nsv820209 CNV loss 19587683

Variation tolerance for OGDH Gene

Residual Variation Intolerance Score: 3.55% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.92; 59.47% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for OGDH Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
OGDH

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for OGDH Gene

Disorders for OGDH Gene

MalaCards: The human disease database

(16) MalaCards diseases for OGDH Gene - From: OMIM, GTR, Orphanet, DISEASES, Novoseek, and GeneCards

- elite association - COSMIC cancer census association via MalaCards
Search OGDH in MalaCards View complete list of genes associated with diseases

Genatlas disease for OGDH Gene

congenital lactic acidosis with hypotonia and progressive neurologic deterioration leading to early death

Additional Disease Information for OGDH

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
genes like me logo Genes that share disorders with OGDH: view

No data available for UniProtKB/Swiss-Prot for OGDH Gene

Publications for OGDH Gene

  1. Cloning and nucleotide sequence of the cDNA encoding human 2-oxoglutarate dehydrogenase (lipoamide). (PMID: 1542694) Koike K … Goto S (Proceedings of the National Academy of Sciences of the United States of America 1992) 2 3 4 23
  2. The gene encoding human 2-oxoglutarate dehydrogenase: structural organization and mapping to chromosome 7p13-p14. (PMID: 7622061) Koike K (Gene 1995) 3 4 23
  3. Localization of the gene (OGDH) coding for the E1k component of the alpha-ketoglutarate dehydrogenase complex to chromosome 7p13-p11.2. (PMID: 8020988) Szabo P … Blass JP (Genomics 1994) 2 3 23
  4. KAT2A coupled with the α-KGDH complex acts as a histone H3 succinyltransferase. (PMID: 29211711) Wang Y … Lu Z (Nature 2017) 3 4
  5. Studies on the regulation of the human E1 subunit of the 2-oxoglutarate dehydrogenase complex, including the identification of a novel calcium-binding site. (PMID: 24495017) Armstrong CT … Denton RM (The Biochemical journal 2014) 3 4

Products for OGDH Gene

Sources for OGDH Gene