This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in... See more...

Aliases for NTRK3 Gene

Aliases for NTRK3 Gene

  • Neurotrophic Receptor Tyrosine Kinase 3 2 3 5
  • TRKC 2 3 4
  • Neurotrophic Tyrosine Kinase, Receptor, Type 3 2 3
  • NT-3 Growth Factor Receptor 3 4
  • EC 2.7.10.1 4 50
  • GP145-TrkC 3 4
  • ETS Related Protein-Neurotrophic Receptor Tyrosine Kinase Fusion Protein 3
  • Neurotrophic Tyrosine Kinase Receptor Type 3 4
  • Tyrosine Kinase Receptor C 3
  • TrkC Tyrosine Kinase 4
  • ETV6-NTRK3 Fusion 3
  • Gp145(TrkC) 3
  • EC 2.7.10 50
  • NTRK3 5
  • Trk-C 4

External Ids for NTRK3 Gene

Previous GeneCards Identifiers for NTRK3 Gene

  • GC15M084556
  • GC15M081649
  • GC15M086007
  • GC15M086149
  • GC15M086221
  • GC15M088402
  • GC15M064532
  • GC15M088418

Summaries for NTRK3 Gene

Entrez Gene Summary for NTRK3 Gene

  • This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]

CIViC Summary for NTRK3 Gene

GeneCards Summary for NTRK3 Gene

NTRK3 (Neurotrophic Receptor Tyrosine Kinase 3) is a Protein Coding gene. Diseases associated with NTRK3 include Fibrosarcoma and Congenital Mesoblastic Nephroma. Among its related pathways are Nanog in Mammalian ESC Pluripotency and Apoptotic Pathways in Synovial Fibroblasts. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is NTRK2.

UniProtKB/Swiss-Prot Summary for NTRK3 Gene

  • Receptor tyrosine kinase involved in nervous system and probably heart development. Upon binding of its ligand NTF3/neurotrophin-3, NTRK3 autophosphorylates and activates different signaling pathways, including the phosphatidylinositol 3-kinase/AKT and the MAPK pathways, that control cell survival and differentiation.

Gene Wiki entry for NTRK3 Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for NTRK3 Gene

Genomics for NTRK3 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for NTRK3 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH15J088255 Promoter/Enhancer 1.9 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas 254.6 0.0 -24 4.4 ZNF600 POLR2A NFIC ZIC2 ZNF341 CTCF SIN3A YY1 ZNF189 TAF1 NTRK3 HSALNG0107962 lnc-NTRK3-4 NTRK3-AS1 MRPL46
GH15J087940 Promoter/Enhancer 0.5 EPDnew Ensembl 250.1 +316.5 316489 1 NTRK3 NTRK3-AS1 MIR11181 lnc-MRPL46-8
GH15J088634 Promoter/Enhancer 2.3 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 9.7 -381.8 -381822 8.7 BCLAF1 SP1 NCOR1 IKZF1 MYC ZNF600 SSRP1 JUND ZNF592 ATF2 ISG20 lnc-DET1-4 POLG NTRK3 AEN ABHD2 HSALNG0107990 lnc-AEN-1 NONHSAG017802.2 ACAN
GH15J089243 Promoter/Enhancer 2 EPDnew Ensembl ENCODE CraniofacialAtlas 9.7 -987.7 -987690 3 SP1 ZNF207 IKZF1 ZNF600 MYC SIX5 JUND ZNF592 CEBPA ZSCAN16 FANCI HSALNG0108023 POLG NTRK3 ENSG00000261441 HSALNG0108024 RF00017-1686
GH15J088917 Enhancer 1.3 Ensembl ENCODE dbSUPER 9.7 -662.8 -662805 4 ZNF600 IKZF1 JUND ZNF592 ATF2 ZNF10 ZIC2 BCL11A CEBPB FEZF1 ENSG00000173867 MFGE8 RPL36AP43 POLG NTRK3 HSALNG0108001 piR-54987-049 RF00017-1685 ABHD2
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around NTRK3 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for NTRK3

Top Transcription factor binding sites by QIAGEN in the NTRK3 gene promoter:
  • ATF-2
  • c-Jun

Genomic Locations for NTRK3 Gene

Latest Assembly
chr15:87,859,749-88,256,796
(GRCh38/hg38)
Size:
397,048 bases
Orientation:
Minus strand

Previous Assembly
chr15:88,402,982-88,799,970
(GRCh37/hg19 by Entrez Gene)
Size:
396,989 bases
Orientation:
Minus strand

chr15:88,418,230-88,799,999
(GRCh37/hg19 by Ensembl)
Size:
381,770 bases
Orientation:
Minus strand

Genomic View for NTRK3 Gene

Genes around NTRK3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
NTRK3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for NTRK3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for NTRK3 Gene

Proteins for NTRK3 Gene

  • Protein details for NTRK3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q16288-NTRK3_HUMAN
    Recommended name:
    NT-3 growth factor receptor
    Protein Accession:
    Q16288
    Secondary Accessions:
    • B7Z4C5
    • E9PG56
    • H0YND1
    • O75682
    • Q12827
    • Q16289

    Protein attributes for NTRK3 Gene

    Size:
    839 amino acids
    Molecular mass:
    94428 Da
    Quaternary structure:
    • Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures (By similarity). Binds SH2B2. Interacts with SQSTM1 and KIDINS220 (By similarity). Interacts with PTPRS (PubMed:25385546). Interacts with MAPK8IP3/JIP3 (By similarity).

    Three dimensional structures from OCA and Proteopedia for NTRK3 Gene

    Alternative splice isoforms for NTRK3 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for NTRK3 Gene

Selected DME Specific Peptides for NTRK3 Gene

Q16288:
  • SINTHQTNLNWTNVHAINLTLVNVTSEDNGF
  • RWMPPESI
  • SKFGMKGP
  • IQPRAFAKNPHLRYI
  • TLNAVDMELYTGLQ
  • HRDLATRN
  • FNCSCDIRW
  • FVHRDLATRNC
  • VKFYGVC
  • QCDLPEISVSHVNLTVREG
  • LTCIAENVVGMSNASV
  • FTYGKQPW
  • LQHEHIVKFYGVC
  • CWQREPQQR
  • EVIECITQGRVL
  • PFPESTDNF
  • LTVYYPPR
  • SEGCLLFNKPTHYNNGNYT
  • YTLIAKN
  • CPKEVYD
  • GDPLIMVFEYMKHGDLN
  • RRDIVLK
  • QAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATR
  • ELGEGAFGKVFLAEC
  • RLNIKEI
  • SINITDISRNITSIHIENW
  • NRLTTLSWQLFQTL
  • TCNGSGS
  • RLEHCIEFVVRGNP
  • FVHRDLA
  • SVLACPANC
  • PDDGNLFPLLEGQDSG

Post-translational modifications for NTRK3 Gene

  • Ligand-mediated auto-phosphorylation.
  • Glycosylation at Asn72, Asn79, Asn133, Asn163, Asn203, Asn218, Asn232, Asn259, Asn267, Asn272, Asn294, Asn375, and Asn388
  • Modification sites at PhosphoSitePlus

Antibodies for research

  • Abcam antibodies for NTRK3

Domains & Families for NTRK3 Gene

Gene Families for NTRK3 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Disease related genes
  • Enzymes
  • Plasma proteins
  • Potential drug targets
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for NTRK3 Gene

InterPro:
Blocks:
  • Immunoglobulin subtype
  • Tyrosine protein kinase, active site
  • Cysteine-rich flanking region, N-terminal
  • Cysteine-rich flanking region, C-terminal
  • Receptor tyrosine kinase, class II

Suggested Antigen Peptide Sequences for NTRK3 Gene

GenScript: Design optimal peptide antigens:
  • Tyrosine-protein kinase receptor (B7Z7U4_HUMAN)
  • Tyrosine-protein kinase receptor (E9PG56_HUMAN)
  • TrkC tyrosine kinase (NTRK3_HUMAN)
  • Neurotrophin 3 receptor (O95192_HUMAN)
  • Neurotrophin 3 receptor truncated isoform (O95193_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q16288

UniProtKB/Swiss-Prot:

NTRK3_HUMAN :
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
genes like me logo Genes that share domains with NTRK3: view

Function for NTRK3 Gene

Molecular function for NTRK3 Gene

UniProtKB/Swiss-Prot Function:
Receptor tyrosine kinase involved in nervous system and probably heart development. Upon binding of its ligand NTF3/neurotrophin-3, NTRK3 autophosphorylates and activates different signaling pathways, including the phosphatidylinositol 3-kinase/AKT and the MAPK pathways, that control cell survival and differentiation.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]; Xref=Rhea:RHEA:10596, Rhea:RHEA-COMP:10136, Rhea:RHEA-COMP:10137, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:46858, ChEBI:CHEBI:82620, ChEBI:CHEBI:456216; EC=2.7.10.1; Evidence={ECO:0000255|PROSITE-ProRule:PRU10028};.
GENATLAS Biochemistry:
receptor tyrosine kinase C,linking neurotrophin 3 (NTF3),containing a CGG repeat in 5'utr,with a translocation t(12;15)(p13;q25) in congenital fibrosarcoma (CFS) and in congenital mesoblastic nephroma (CMN),involved in the survival and differentiation of nervous system and heart,and in tumour development

Enzyme Numbers (IUBMB) for NTRK3 Gene

Phenotypes From GWAS Catalog for NTRK3 Gene

Gene Ontology (GO) - Molecular Function for NTRK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0002039 p53 binding IPI 23027130
GO:0004672 protein kinase activity IEA --
GO:0004713 protein tyrosine kinase activity IEA --
GO:0004714 transmembrane receptor protein tyrosine kinase activity IBA 21873635
genes like me logo Genes that share ontologies with NTRK3: view
genes like me logo Genes that share phenotypes with NTRK3: view

Animal Models for NTRK3 Gene

MGI Knock Outs for NTRK3:

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for NTRK3

Clone products for research

  • Addgene plasmids for NTRK3

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for NTRK3 Gene

Localization for NTRK3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for NTRK3 Gene

Membrane. Single-pass type I membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for NTRK3 gene
Compartment Confidence
plasma membrane 5
extracellular 3
cytoskeleton 3
nucleus 3
cytosol 3
mitochondrion 2
endoplasmic reticulum 2
endosome 2
lysosome 2
peroxisome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoli (3)
  • Nucleoli rim (3)
  • Nuclear membrane (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for NTRK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005886 plasma membrane TAS --
GO:0005887 integral component of plasma membrane TAS,IBA 21873635
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
GO:0030424 axon IBA 21873635
genes like me logo Genes that share ontologies with NTRK3: view

Pathways & Interactions for NTRK3 Gene

PathCards logo

SuperPathways for NTRK3 Gene

SuperPathway Contained pathways
1 Apoptotic Pathways in Synovial Fibroblasts
.85
.85
.84
.84
.74
.72
.66
.65
.62
.61
.60
.57
.57
2 GPCR Pathway
.73
.73
.62
.59
.58
.58
.55
.38
3 ERK Signaling
.61
.61
.58
.51
.49
4 Nanog in Mammalian ESC Pluripotency
.61
.61
.59
.48
5 Apoptosis Pathway
genes like me logo Genes that share pathways with NTRK3: view

Pathways by source for NTRK3 Gene

2 GeneGo (Thomson Reuters) pathways for NTRK3 Gene
  • Development MAG-dependent inhibition of neurite outgrowth
  • Development Neurotrophin family signaling
3 Tocris pathways for NTRK3 Gene
55 Qiagen pathways for NTRK3 Gene
  • 14-3-3 Induced Intracellular Signaling
  • Actin Nucleation and Branching
  • Actin Nucleation by ARP-WASP Complex
  • Actin-Based Motility by Rho Family GTPases
  • Activation of cAMP-Dependent PKA
1 Cell Signaling Technology pathway for NTRK3 Gene

SIGNOR curated interactions for NTRK3 Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for NTRK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000187 activation of MAPK activity IDA 23027130
GO:0001764 neuron migration IEA --
GO:0001933 negative regulation of protein phosphorylation IDA 23027130
GO:0001934 positive regulation of protein phosphorylation TAS 19036963
GO:0006468 protein phosphorylation IEA --
genes like me logo Genes that share ontologies with NTRK3: view

Drugs & Compounds for NTRK3 Gene

(24) Drugs for NTRK3 Gene - From: DrugBank, PharmGKB, ClinicalTrials, ApexBio, DGIdb, IUPHAR, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Entrectinib Approved, Investigational Pharma Target, inhibitor Orally active inhibitor of ALK kinase 24
Tyrosine Approved, Investigational Nutra 1149
fostamatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors 0
Larotrectinib Approved, Investigational Pharma Target, inhibitor 0
Pralsetinib Approved, Investigational Pharma Target, inhibitor 0

(9) Additional Compounds for NTRK3 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
58-64-0

(4) ApexBio Compounds for NTRK3 Gene

Compound Action Cas Number
7,8-Dihydroxyflavone 38183-03-8
BDNF (human) 218441-99-7
LM 22A4 37988-18-4
NTR 368 197230-90-3
genes like me logo Genes that share compounds with NTRK3: view

Drug products for research

Transcripts for NTRK3 Gene

mRNA/cDNA for NTRK3 Gene

11 REFSEQ mRNAs :
34 NCBI additional mRNA sequence :
21 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for NTRK3

Clone products for research

  • Addgene plasmids for NTRK3

Alternative Splicing Database (ASD) splice patterns (SP) for NTRK3 Gene

ExUns: 1 ^ 2a · 2b ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8a · 8b ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^ 22 ^ 23 ^ 24a ·
SP1: - - - - - -
SP2: - - - - -
SP3: - - -
SP4: - - - -
SP5:
SP6:

ExUns: 24b
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:

Relevant External Links for NTRK3 Gene

GeneLoc Exon Structure for
NTRK3

Expression for NTRK3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for NTRK3 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for NTRK3 Gene

This gene is overexpressed in Artery - Tibial (x6.0) and Artery - Coronary (x4.2).

Protein differential expression in normal tissues from HIPED for NTRK3 Gene

This gene is overexpressed in Frontal cortex (29.9), Fetal Brain (17.7), and Brain (14.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for NTRK3 Gene



Protein tissue co-expression partners for NTRK3 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for NTRK3

SOURCE GeneReport for Unigene cluster for NTRK3 Gene:

Hs.410969

mRNA Expression by UniProt/SwissProt for NTRK3 Gene:

Q16288-NTRK3_HUMAN
Tissue specificity: Widely expressed but mainly in nervous tissue. Isoform 2 is expressed at higher levels in adult brain than in fetal brain.

Evidence on tissue expression from TISSUES for NTRK3 Gene

  • Nervous system(4.9)
  • Muscle(2.3)
  • Adrenal gland(2.3)
  • Intestine(2.2)
  • Blood(2.2)
  • Eye(2.1)
  • Thyroid gland(2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for NTRK3 Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • endocrine
  • skeleton
Regions:
Head and neck:
  • head
  • jaw
  • mandible
  • maxilla
  • mouth
  • neck
  • skull
  • thyroid
Thorax:
  • chest wall
  • clavicle
  • rib
  • rib cage
  • scapula
  • sternum
Pelvis:
  • pelvis
Limb:
  • ankle
  • arm
  • digit
  • elbow
  • femur
  • fibula
  • finger
  • foot
  • forearm
  • hand
  • hip
  • humerus
  • knee
  • lower limb
  • radius
  • shin
  • shoulder
  • thigh
  • tibia
  • toe
  • ulna
  • upper limb
  • wrist
General:
  • spinal column
  • vertebrae
genes like me logo Genes that share expression patterns with NTRK3: view

Primer products for research

Orthologs for NTRK3 Gene

This gene was present in the common ancestor of animals.

Orthologs for NTRK3 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia NTRK3 29 30
  • 99.39 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia -- 30
  • 97 (a)
OneToMany
NTRK3 29 30
  • 92.98 (n)
OneToMany
Oppossum
(Monodelphis domestica)
Mammalia NTRK3 30
  • 94 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia -- 30
  • 94 (a)
OneToMany
-- 30
  • 85 (a)
OneToMany
Dog
(Canis familiaris)
Mammalia NTRK3 29 30
  • 91.45 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Ntrk3 29 16 30
  • 91.03 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Ntrk3 29
  • 90.98 (n)
Chicken
(Gallus gallus)
Aves NTRK3 29 30
  • 82.12 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia -- 30
  • 90 (a)
OneToMany
-- 30
  • 73 (a)
OneToMany
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia ntrk3 29
  • 75.09 (n)
Zebrafish
(Danio rerio)
Actinopterygii ntrk3b 30
  • 77 (a)
OneToMany
ntrk3a 29 30
  • 71.42 (n)
OneToMany
Worm
(Caenorhabditis elegans)
Secernentea Y69E1A.3 31
  • 33 (a)
trk-1 30
  • 22 (a)
OneToMany
Species where no ortholog for NTRK3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Fruit Fly (Drosophila melanogaster)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for NTRK3 Gene

ENSEMBL:
Gene Tree for NTRK3 (if available)
TreeFam:
Gene Tree for NTRK3 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for NTRK3: view image
Alliance of Genome Resources:
Additional Orthologs for NTRK3

Paralogs for NTRK3 Gene

(14) SIMAP similar genes for NTRK3 Gene using alignment to 9 proteins:

  • NTRK3_HUMAN
  • B7Z7U4_HUMAN
  • H0YM90_HUMAN
  • O95192_HUMAN
  • O95193_HUMAN
  • Q96CY4_HUMAN
  • R4GMR8_HUMAN
  • R4GN40_HUMAN
  • R4GNH5_HUMAN
genes like me logo Genes that share paralogs with NTRK3: view

Variants for NTRK3 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for NTRK3 Gene

SNP ID Clinical significance and condition Chr 15 pos Variation AA Info Type
791597 Likely Benign: not provided 88,136,554(-) G/.
NM_001012338.2(NTRK3):c.678T>C (p.Asn226=)
SYNONYMOUS_VARIANT,NO_SEQUENCE_ALTERATION
rs138836357 A lung adenocarcinoma sample p.Val307Leu
rs149275429 Benign: not provided 88,136,458(-) G/C
NM_001012338.2(NTRK3):c.765+9C>G
INTRON
rs150063863 Likely Benign: not provided 87,929,428(-) A/G
NM_001012338.2(NTRK3):c.1896T>C (p.His632=)
SYNONYMOUS
rs200822610 Likely Benign: not provided 88,256,093(-) C/Ap.Val21Phe
NM_001012338.2(NTRK3):c.61G>T (p.Val21Phe)
MISSENSE

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for NTRK3 Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for NTRK3 Gene

Variant ID Type Subtype PubMed ID
esv2608620 CNV deletion 19546169
esv2749991 CNV deletion 23290073
esv3307702 CNV mobile element insertion 20981092
esv3386964 CNV insertion 20981092
esv3552816 CNV deletion 23714750
esv3637165 CNV loss 21293372
esv3637167 CNV loss 21293372
nsv1108973 CNV deletion 24896259
nsv527970 CNV gain 19592680
nsv827427 CNV gain 20364138
nsv94255 CNV deletion 16902084
nsv952020 CNV duplication 24416366
nsv952021 CNV deletion 24416366

Variation tolerance for NTRK3 Gene

Residual Variation Intolerance Score: 3.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.48; 28.90% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for NTRK3 Gene

Human Gene Mutation Database (HGMD)
NTRK3
SNPedia medical, phenotypic, and genealogical associations of SNPs for
NTRK3
Leiden Open Variation Database (LOVD)
NTRK3

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for NTRK3 Gene

Disorders for NTRK3 Gene

MalaCards: The human disease database

(56) MalaCards diseases for NTRK3 Gene - From: ORP, COP, and GCD

Disorder Aliases PubMed IDs
fibrosarcoma
  • fibrocytic tumor
congenital mesoblastic nephroma
  • nephroma, mesoblastic
differentiated thyroid carcinoma
  • papillary or follicular thyroid carcinoma
congenital fibrosarcoma
  • infantile fibrosarcoma
nephroma
  • benign nephroma
- elite association - COSMIC cancer census association via MalaCards
Search NTRK3 in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

NTRK3_HUMAN
  • Note=Defects in NTRK3 are associated with susceptibility to congenital heart defects (CHD). A disease characterized by congenital developmental abnormalities involving structures of the heart. CHD are the most common major birth defects and the leading cause of death from congenital malformations. {ECO:0000269 PubMed:25196463}.

Additional Disease Information for NTRK3

Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform
genes like me logo Genes that share disorders with NTRK3: view

No data available for Genatlas for NTRK3 Gene

Publications for NTRK3 Gene

  1. Molecular cloning of the cDNA for human TrkC (NTRK3), chromosomal assignment, and evidence for a splice variant. (PMID: 7806211) McGregor LM … Nelkin BD (Genomics 1994) 2 3 4 22
  2. Evidence for a possible association of neurotrophin receptor (NTRK-3) gene polymorphisms with hippocampal function and schizophrenia. (PMID: 19344762) Otnaess MK … Andreassen OA (Neurobiology of disease 2009) 3 22 40
  3. A novel point variant in NTRK3, R645C, suggests a role of this gene in the pathogenesis of Hirschsprung disease. (PMID: 19040714) Fernández RM … Borrego S (Annals of human genetics 2009) 3 22 40
  4. Allele variants in functional MicroRNA target sites of the neurotrophin-3 receptor gene (NTRK3) as susceptibility factors for anxiety disorders. (PMID: 19370765) Muiños-Gimeno M … Espinosa-Parrilla Y (Human mutation 2009) 3 22 40
  5. Frequent mutations in the neurotrophic tyrosine receptor kinase gene family in large cell neuroendocrine carcinoma of the lung. (PMID: 18293376) Marchetti A … Buttitta F (Human mutation 2008) 3 4 22

Products for NTRK3 Gene

  • Addgene plasmids for NTRK3