This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine residues in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with heparin-binding EGF-like growth factor and plays a role in cell migration and proliferation. Multiple transcript variants encoding different isoforms have been found f... See more...

Aliases for NRDC Gene

Aliases for NRDC Gene

  • Nardilysin Convertase 2 3 4 5
  • Nardilysin (N-Arginine Dibasic Convertase) 2 3
  • N-Arginine Dibasic Convertase 2 4
  • NRD Convertase 3 4
  • EC 3.4.24.61 4 52
  • Nardilysin 3 4
  • NRD1 3 4
  • EC 3.4.24 52
  • HNRD1 3
  • HNRD2 3
  • NRD-C 4

External Ids for NRDC Gene

Previous HGNC Symbols for NRDC Gene

  • NRD1

Summaries for NRDC Gene

Entrez Gene Summary for NRDC Gene

  • This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine residues in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with heparin-binding EGF-like growth factor and plays a role in cell migration and proliferation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

GeneCards Summary for NRDC Gene

NRDC (Nardilysin Convertase) is a Protein Coding gene. An important paralog of this gene is IDE.

UniProtKB/Swiss-Prot Summary for NRDC Gene

  • Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Gene Wiki entry for NRDC Gene

Additional gene information for NRDC Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for NRDC Gene

Genomics for NRDC Gene

GeneHancer (GH) Regulatory Elements for NRDC Gene

Promoters and enhancers for NRDC Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around NRDC on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for NRDC

Genomic Locations for NRDC Gene

Genomic Locations for NRDC Gene
chr1:51,789,191-51,878,937
(GRCh38/hg38)
Size:
89,747 bases
Orientation:
Minus strand
chr1:52,254,863-52,344,609
(GRCh37/hg19)
Size:
89,747 bases
Orientation:
Minus strand

Genomic View for NRDC Gene

Genes around NRDC on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
NRDC Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for NRDC Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for NRDC Gene

Proteins for NRDC Gene

  • Protein details for NRDC Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O43847-NRDC_HUMAN
    Recommended name:
    Nardilysin
    Protein Accession:
    O43847
    Secondary Accessions:
    • A6NI41
    • O15241
    • O15242
    • Q5VUL0
    • Q96HB2
    • Q9NU57

    Protein attributes for NRDC Gene

    Size:
    1151 amino acids
    Molecular mass:
    131701 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAC39597.1; Type=Frameshift; Evidence={ECO:0000305};

    Alternative splice isoforms for NRDC Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for NRDC Gene

Selected DME Specific Peptides for NRDC Gene

O43847:
  • NILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHK
  • SAANVVLFDIF
  • GHEGKGSILS

Post-translational modifications for NRDC Gene

  • Ubiquitination at Lys326, Lys342, and Lys352
  • Modification sites at PhosphoSitePlus

Other Protein References for NRDC Gene

Domains & Families for NRDC Gene

Gene Families for NRDC Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for NRDC Gene

Blocks:
  • Insulinase-like peptidase, family M16
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for NRDC Gene

GenScript: Design optimal peptide antigens:
  • N-arginine dibasic convertase (NRDC_HUMAN)
  • Nardilysin (N-arginine dibasic convertase) (Q5TFB9_HUMAN)
  • Nardilysin isoform (Q6UUU9_HUMAN)
  • Nardilysin (Q96L67_HUMAN)

Graphical View of Domain Structure for InterPro Entry

O43847

UniProtKB/Swiss-Prot:

NRDC_HUMAN :
  • Belongs to the peptidase M16 family.
Family:
  • Belongs to the peptidase M16 family.
genes like me logo Genes that share domains with NRDC: view

Function for NRDC Gene

Molecular function for NRDC Gene

UniProtKB/Swiss-Prot Function:
Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=Hydrolysis of polypeptides, preferably at -Xaa- -Arg-Lys-, and less commonly at -Arg- -Arg-Xaa-, in which Xaa is not Arg or Lys.; EC=3.4.24.61;.

Enzyme Numbers (IUBMB) for NRDC Gene

Phenotypes From GWAS Catalog for NRDC Gene

Gene Ontology (GO) - Molecular Function for NRDC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004222 metalloendopeptidase activity IEA,NAS 9581555
GO:0005515 protein binding IPI 18355445
GO:0008233 peptidase activity IEA --
GO:0008237 metallopeptidase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with NRDC: view
genes like me logo Genes that share phenotypes with NRDC: view

Animal Models for NRDC Gene

MGI Knock Outs for NRDC:
  • Nrd1 Nrd1<tm1Eiin>

Animal Model Products

  • Taconic Biosciences Mouse Models for NRDC

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for NRDC Gene

Localization for NRDC Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for NRDC gene
Compartment Confidence
mitochondrion 5
cytosol 5
nucleus 3
plasma membrane 1
extracellular 1
cytoskeleton 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for NRDC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005739 mitochondrion IDA 28017472
GO:0005829 cytosol TAS 12463163
GO:0009986 cell surface TAS 12463163
genes like me logo Genes that share ontologies with NRDC: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for NRDC Gene

Pathways & Interactions for NRDC Gene

PathCards logo

SuperPathways for NRDC Gene

No Data Available

Gene Ontology (GO) - Biological Process for NRDC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis NAS,IEA 9581555
GO:0007528 neuromuscular junction development TAS 9479496
GO:0008283 cell proliferation TAS 12463163
GO:0016477 cell migration TAS 15544571
GO:0051044 positive regulation of membrane protein ectodomain proteolysis IDA 18355445
genes like me logo Genes that share ontologies with NRDC: view

No data available for Pathways by source and SIGNOR curated interactions for NRDC Gene

Drugs & Compounds for NRDC Gene

(2) Drugs for NRDC Gene - From: Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
genes like me logo Genes that share compounds with NRDC: view

Transcripts for NRDC Gene

mRNA/cDNA for NRDC Gene

3 REFSEQ mRNAs :
16 NCBI additional mRNA sequence :
14 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for NRDC Gene

No ASD Table

Relevant External Links for NRDC Gene

GeneLoc Exon Structure for
NRDC

Expression for NRDC Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for NRDC

mRNA Expression by UniProt/SwissProt for NRDC Gene:

O43847-NRDC_HUMAN
Tissue specificity: Primarily in adult heart, skeletal muscle, and testis and at much lower levels in other tissues.

Evidence on tissue expression from TISSUES for NRDC Gene

  • Nervous system(4.7)
  • Liver(4.4)
  • Heart(4.3)
  • Skin(3)
  • Lung(2.9)
  • Muscle(2)

No data available for mRNA expression in normal human tissues , mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues , Protein expression , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for NRDC Gene

Orthologs for NRDC Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for NRDC Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia NRD1 31 30
  • 99.59 (n)
OneToOne
cow
(Bos Taurus)
Mammalia NRD1 31 30
  • 93.96 (n)
OneToOne
dog
(Canis familiaris)
Mammalia NRD1 31 30
  • 93.6 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Nrd1 17 31 30
  • 90.59 (n)
rat
(Rattus norvegicus)
Mammalia Nrd1 30
  • 89.24 (n)
oppossum
(Monodelphis domestica)
Mammalia NRD1 31
  • 83 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia NRD1 31
  • 75 (a)
OneToOne
chicken
(Gallus gallus)
Aves NRD1 31 30
  • 75.63 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia -- 31
  • 70 (a)
OneToMany
-- 31
  • 64 (a)
OneToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia nrd1 30
  • 66.27 (n)
zebrafish
(Danio rerio)
Actinopterygii NRD1 (1 of 2) 31
  • 69 (a)
OneToMany
si:dkey-193b15.9 30
  • 68 (n)
nrd1 31
  • 64 (a)
OneToMany
wufk24c07 30
fruit fly
(Drosophila melanogaster)
Insecta CG10588 31
  • 31 (a)
OneToMany
CG2025 31
  • 31 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes STE23 31
  • 27 (a)
OneToMany
thale cress
(Arabidopsis thaliana)
eudicotyledons AT1G06900 30
  • 47.34 (n)
rice
(Oryza sativa)
Liliopsida Os03g0336300 30
  • 47.87 (n)
Species where no ortholog for NRDC was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for NRDC Gene

ENSEMBL:
Gene Tree for NRDC (if available)
TreeFam:
Gene Tree for NRDC (if available)
Aminode:
Evolutionary constrained regions (ECRs) for NRDC: view image

Paralogs for NRDC Gene

Paralogs for NRDC Gene

genes like me logo Genes that share paralogs with NRDC: view

Variants for NRDC Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for NRDC Gene

SNP ID Clinical significance and condition Chr 01 pos Variation AA Info Type
711769 Benign: not provided 51,878,485(-) G/A MISSENSE_VARIANT
780238 Benign: not provided 51,878,439(-) G/A SYNONYMOUS_VARIANT
rs777243211 Uncertain Significance: not provided 51,812,069(-) CAT/C FRAMESHIFT_VARIANT
rs34957144 - p.Tyr832Ser

Additional dbSNP identifiers (rs#s) for NRDC Gene

Structural Variations from Database of Genomic Variants (DGV) for NRDC Gene

Variant ID Type Subtype PubMed ID
dgv82n106 CNV deletion 24896259
esv1546529 CNV insertion 17803354
esv1684865 CNV insertion 17803354
esv2551965 CNV insertion 19546169
esv3349028 CNV insertion 20981092
esv3586044 CNV gain 21293372
nsv1110660 CNV insertion 24896259
nsv512738 CNV insertion 21212237
nsv519495 CNV loss 19592680
nsv829837 CNV loss 17160897
nsv956714 CNV insertion 24416366

Variation tolerance for NRDC Gene

Residual Variation Intolerance Score: 3.39% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.48; 43.56% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for NRDC Gene

Human Gene Mutation Database (HGMD)
NRDC
SNPedia medical, phenotypic, and genealogical associations of SNPs for
NRDC

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for NRDC Gene

Disorders for NRDC Gene

Additional Disease Information for NRDC

No disorders were found for NRDC Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for NRDC Gene

Publications for NRDC Gene

  1. Human NRD convertase: a highly conserved metalloendopeptidase expressed at specific sites during development and in adult tissues. (PMID: 9479496) Fumagalli P … Taramelli R (Genomics 1998) 2 3 4 23 54
  2. Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family. (PMID: 9581555) Hospital V … Cohen P (The Biochemical journal 1997) 2 3 4 23 54
  3. Gene expression of the dibasic-pair cleaving enzyme NRD convertase (N-arginine dibasic convertase) is differentially regulated in the GH3 pituitary and Mat-Lu prostate cell lines. (PMID: 11042131) Winter AG … Pierotti AR (The Biochemical journal 2000) 3 4 23 54
  4. Ectodomain shedding of TNF-alpha is enhanced by nardilysin via activation of ADAM proteases. (PMID: 18355445) Hiraoka Y … Nishi E (Biochemical and biophysical research communications 2008) 3 23 54
  5. Histochemical evidence for wide expression of the metalloendopeptidase nardilysin in human brain neurons. (PMID: 17442499) Bernstein HG … Reiser G (Neuroscience 2007) 3 23 54

Products for NRDC Gene

Sources for NRDC Gene