Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 [PubMed 7982997]). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surface receptors with a similar topographic structure: an extracellular ligand-binding domain, a single membrane-spanning domain, ... See more...

Aliases for NPR1 Gene

Aliases for NPR1 Gene

  • Natriuretic Peptide Receptor 1 2 3 5
  • Guanylate Cyclase A 2 3 4
  • Atrial Natriuretic Peptide Receptor Type A 3 4
  • Atrial Natriuretic Peptide Receptor 1 3 4
  • Atrionatriuretic Peptide Receptor A 2 3
  • Natriuretic Peptide Receptor A 2 3
  • EC 4.6.1.2 4 51
  • GUCY2A 2 3
  • ANPR-A 3 4
  • ANPRA 3 4
  • ANP-A 3 4
  • NPR-A 3 4
  • ANPa 2 3
  • GC-A 3 4
  • Natriuretic Peptide Receptor A/Guanylate Cyclase A (Atrionatriuretic Peptide Receptor A) 3
  • Natriuretic Peptide A Type Receptor 3
  • Testicular Tissue Protein Li 20 3
  • GUC2A 3
  • NPRA 3
  • NPR1 5

External Ids for NPR1 Gene

Previous HGNC Symbols for NPR1 Gene

  • ANPRA
  • NPRA

Previous GeneCards Identifiers for NPR1 Gene

  • GC01P151499
  • GC01P149382
  • GC01P150426
  • GC01P150867
  • GC01P150465
  • GC01P151917
  • GC01P153651
  • GC01P125014
  • GC01P153679
  • GC01P153683
  • GC01P153686
  • GC01P153688
  • GC01P153691
  • GC01P153680

Summaries for NPR1 Gene

Entrez Gene Summary for NPR1 Gene

  • Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 [PubMed 7982997]). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surface receptors with a similar topographic structure: an extracellular ligand-binding domain, a single membrane-spanning domain, and an intracellular region that contains a protein kinase-like domain and a cyclase catalytic domain. GC-A and GC-B function as receptors for natriuretic peptides; they are also referred to as atrial natriuretic peptide receptor A (NPR1) and type B (NPR2; MIM 108961). Also see NPR3 (MIM 108962), which encodes a protein with only the ligand-binding transmembrane and 37-amino acid cytoplasmic domains. NPR1 is a membrane-bound guanylate cyclase that serves as the receptor for both atrial and brain natriuretic peptides (ANP (MIM 108780) and BNP (MIM 600295), respectively).[supplied by OMIM, May 2009]

GeneCards Summary for NPR1 Gene

NPR1 (Natriuretic Peptide Receptor 1) is a Protein Coding gene. Diseases associated with NPR1 include Hypertensive Heart Disease and Congestive Heart Failure. Among its related pathways are Sweet Taste Signaling and Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is NPR2.

UniProtKB/Swiss-Prot Summary for NPR1 Gene

  • Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.

Tocris Summary for NPR1 Gene

  • Natriuretic peptide (NP) receptors are single transmembrane catalytic receptors with intracellular guanylyl cyclase activity. There are three isoforms of NP receptors; NPR1-3, which have conserved catalytic and regulatory domains and divergent ligand binding domains.

Gene Wiki entry for NPR1 Gene

No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for NPR1 Gene

Genomics for NPR1 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for NPR1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around NPR1 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for NPR1

Top Transcription factor binding sites by QIAGEN in the NPR1 gene promoter:
  • E2F
  • E2F-1
  • GATA-1
  • Nkx2-5
  • Sp1

Genomic Locations for NPR1 Gene

Genomic Locations for NPR1 Gene
chr1:153,678,649-153,693,992
(GRCh38/hg38)
Size:
15,344 bases
Orientation:
Plus strand
chr1:153,651,113-153,666,468
(GRCh37/hg19)
Size:
15,356 bases
Orientation:
Plus strand

Genomic View for NPR1 Gene

Genes around NPR1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
NPR1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for NPR1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for NPR1 Gene

Proteins for NPR1 Gene

  • Protein details for NPR1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P16066-ANPRA_HUMAN
    Recommended name:
    Atrial natriuretic peptide receptor 1
    Protein Accession:
    P16066
    Secondary Accessions:
    • B0ZBF0
    • Q5SR08
    • Q6P4Q3

    Protein attributes for NPR1 Gene

    Size:
    1061 amino acids
    Molecular mass:
    118919 Da
    Quaternary structure:
    • Homodimer.

neXtProt entry for NPR1 Gene

Selected DME Specific Peptides for NPR1 Gene

P16066:
  • GSLQDILEN
  • LVEERTQAYLEEKRKAE
  • NDIVKGM
  • RMEQYANNLE
  • QLRLRIG
  • SFRIRHRP
  • YKVETIGDAY
  • LLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGF
  • VLFELKHMRDVQ
  • LLNDLYT
  • FSDIVGFT
  • LKSSNCVVD
  • AKKLWTAPELL
  • PRYCLFGDTVNTASRMES
  • MPRYCLFG
  • ARMALALLDAV

Post-translational modifications for NPR1 Gene

  • Phosphorylation of the protein kinase-like domain is required for full activation by ANP.
  • Glycosylation at Asn34, Asn45, Asn212, Asn338, Asn379, Asn386, and Asn427
  • Modification sites at PhosphoSitePlus

Other Protein References for NPR1 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for NPR1 Gene

Gene Families for NPR1 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • FDA approved drug targets
  • Predicted membrane proteins

Protein Domains for NPR1 Gene

InterPro:
Blocks:
  • Extracellular ligand-binding receptor
  • Natriuretic peptide receptor, N-terminal
ProtoNet:

Suggested Antigen Peptide Sequences for NPR1 Gene

GenScript: Design optimal peptide antigens:
  • Guanylate cyclase A (ANPRA_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P16066

UniProtKB/Swiss-Prot:

ANPRA_HUMAN :
  • Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
Family:
  • Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
genes like me logo Genes that share domains with NPR1: view

Function for NPR1 Gene

Molecular function for NPR1 Gene

UniProtKB/Swiss-Prot Function:
Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=GTP = 3',5'-cyclic GMP + diphosphate; Xref=Rhea:RHEA:13665, ChEBI:CHEBI:33019, ChEBI:CHEBI:37565, ChEBI:CHEBI:57746; EC=4.6.1.2;.
GENATLAS Biochemistry:
natriuretic peptide,receptor A,expressed in kidney,vascular endothelium and adrenal glands,responding to ANP (NPPA) and to a lesser degree to BNP by mediating vasorelaxant and natriuretic functions and decreasing aldosterone synthesis

Enzyme Numbers (IUBMB) for NPR1 Gene

Phenotypes From GWAS Catalog for NPR1 Gene

Gene Ontology (GO) - Molecular Function for NPR1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0001653 peptide receptor activity IBA 21873635
GO:0004383 guanylate cyclase activity IBA,IDA 1672777
GO:0004672 protein kinase activity IEA --
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with NPR1: view
genes like me logo Genes that share phenotypes with NPR1: view

Animal Models for NPR1 Gene

MGI Knock Outs for NPR1:

Animal Model Products

CRISPR Products

miRNA for NPR1 Gene

miRTarBase miRNAs that target NPR1

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for NPR1

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for NPR1 Gene

Localization for NPR1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for NPR1 Gene

Membrane. Single-pass type I membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for NPR1 gene
Compartment Confidence
plasma membrane 4
nucleus 3
extracellular 2
cytoskeleton 2
mitochondrion 2
endoplasmic reticulum 2
cytosol 2
lysosome 2
golgi apparatus 2
peroxisome 1
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoli (2)
  • Nucleoplasm (2)
  • Plasma membrane (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for NPR1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005886 plasma membrane IEA,TAS --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
GO:0043235 receptor complex IDA 23382219
genes like me logo Genes that share ontologies with NPR1: view

Pathways & Interactions for NPR1 Gene

PathCards logo

SuperPathways for NPR1 Gene

SuperPathway Contained pathways
1 G-Beta Gamma Signaling
.44
.37
.30
2 Cardiac conduction
3 Oxytocin signaling pathway
4 Sweet Taste Signaling
.46
.37
5 Aldosterone synthesis and secretion
genes like me logo Genes that share pathways with NPR1: view

Pathways by source for NPR1 Gene

9 Qiagen pathways for NPR1 Gene
  • Cellular Effects of Sildenafil
  • CRHR Pathway
  • eNOS Signaling
  • Intracellular Calcium Signaling
  • Relaxin Pathway

SIGNOR curated interactions for NPR1 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for NPR1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006182 cGMP biosynthetic process IDA 1672777
GO:0006468 protein phosphorylation IEA --
GO:0007165 signal transduction IBA 21873635
GO:0007166 cell surface receptor signaling pathway NAS 12547834
GO:0007168 receptor guanylyl cyclase signaling pathway IBA,IDA 1672777
genes like me logo Genes that share ontologies with NPR1: view

Drugs & Compounds for NPR1 Gene

(39) Drugs for NPR1 Gene - From: DrugBank, ApexBio, DGIdb, IUPHAR, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Erythrityl Tetranitrate Approved, Experimental, Investigational Pharma Target, agonist, stimulator 0
Isosorbide Dinitrate Approved, Investigational Pharma Target, agonist, stimulator 86
Nitroglycerin Approved, Investigational Pharma Target, agonist, inhibitor, stimulator 229
Nitroprusside Approved, Investigational Pharma Target, agonist, antagonist 81
Nesiritide Approved, Investigational Pharma Target, binder 0

(12) Additional Compounds for NPR1 Gene - From: Novoseek, IUPHAR, Tocris, and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
[<sup>125</sup>I]ANP
pyrophosphate
  • [(ho)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • PYROphosphATE
14000-31-8
AP 811
124833-45-0
Atrial natriuretic factor (1-28) (human, porcine)
91917-63-4

(5) Tocris Compounds for NPR1 Gene

Compound Action Cas Number
AP 811 High affinity, selective NPR3 antagonist 124833-45-0
Atrial natriuretic factor (1-28) (human, porcine) Endogenous peptide regulating blood pressure 91917-63-4
Atrial natriuretic factor (1-28) (rat) Endogenous peptide regulating blood pressure 88898-17-3
Brain natriuretic peptide (1-32) (human) Endogenous peptide agonist at ANP receptor A (NPR1) 124584-08-3
C-type natriuretic peptide (1-22) (human, rat, swine) Endogenous peptide agonist at NPR2 127869-51-6

(1) ApexBio Compounds for NPR1 Gene

Compound Action Cas Number
BNP (1-32), human Brain natriuretic peptide 114471-18-0
genes like me logo Genes that share compounds with NPR1: view

Drug Products

Transcripts for NPR1 Gene

mRNA/cDNA for NPR1 Gene

1 REFSEQ mRNAs :
7 NCBI additional mRNA sequence :
3 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for NPR1

Alternative Splicing Database (ASD) splice patterns (SP) for NPR1 Gene

ExUns: 1 ^ 2a · 2b ^ 3 ^ 4 ^ 5a · 5b · 5c · 5d ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12
SP1:
SP2:
SP3: - - -
SP4: - -
SP5: -

Relevant External Links for NPR1 Gene

GeneLoc Exon Structure for
NPR1

Expression for NPR1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for NPR1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for NPR1 Gene

This gene is overexpressed in Artery - Aorta (x9.6) and Adipose - Visceral (Omentum) (x5.1).

Protein differential expression in normal tissues from HIPED for NPR1 Gene

This gene is overexpressed in Cervix (26.2), Serum (24.4), and Adipocyte (12.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for NPR1 Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for NPR1

SOURCE GeneReport for Unigene cluster for NPR1 Gene:

Hs.490330

Evidence on tissue expression from TISSUES for NPR1 Gene

  • Kidney(4.6)
  • Blood(4.5)
  • Eye(4.4)
  • Nervous system(3)
  • Heart(3)
  • Muscle(2.8)
  • Adrenal gland(2.6)
  • Skin(2.5)
  • Intestine(2.3)
  • Lung(2.2)
  • Pancreas(2)
genes like me logo Genes that share expression patterns with NPR1: view

No data available for Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for NPR1 Gene

Orthologs for NPR1 Gene

This gene was present in the common ancestor of animals.

Orthologs for NPR1 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia NPR1 30 31
  • 98.71 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia NPR1 30 31
  • 91.05 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia NPR1 30 31
  • 90.03 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Npr1 30
  • 87.54 (n)
Mouse
(Mus musculus)
Mammalia Npr1 30 17 31
  • 87.04 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia NPR1 31
  • 71 (a)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia -- 31
  • 34 (a)
ManyToMany
Chicken
(Gallus gallus)
Aves -- 31
  • 34 (a)
ManyToMany
Lizard
(Anolis carolinensis)
Reptilia NPR1 31
  • 87 (a)
OneToOne
African clawed frog
(Xenopus laevis)
Amphibia MGC68769 30
Zebrafish
(Danio rerio)
Actinopterygii npr1a 30 31
  • 66.01 (n)
OneToMany
NPR1 (1 of 2) 31
  • 62 (a)
OneToMany
Fruit Fly
(Drosophila melanogaster)
Insecta CG5719 32
  • 56 (a)
CG3216 30 32
  • 54.41 (n)
CG14886 32
  • 38 (a)
CG10738 32
  • 37 (a)
Gyc32E 32
  • 35 (a)
Gyc76C 32
  • 35 (a)
CG31183 31
  • 32 (a)
OneToMany
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP008691 30
  • 54.47 (n)
Worm
(Caenorhabditis elegans)
Secernentea T01A4.1b 32
  • 58 (a)
T01A4.1a 32
  • 54 (a)
gcy-21 32
  • 46 (a)
gcy-15 32
  • 45 (a)
gcy-14 32
  • 42 (a)
gcy-31 32
  • 40 (a)
gcy-28 31
  • 36 (a)
OneToMany
gcy-11 32
  • 36 (a)
gcy-7 32
  • 34 (a)
gcy-27 32
  • 32 (a)
odr-1 32
  • 32 (a)
gcy-20 32
  • 32 (a)
gcy-12 32
  • 32 (a)
gcy-22 32
  • 31 (a)
gcy-5 32
  • 31 (a)
gcy-6 32
  • 31 (a)
daf-11 32
  • 30 (a)
gcy-2 32
  • 30 (a)
gcy-3 32
  • 30 (a)
gcy-19 32
  • 30 (a)
gcy-13 32
  • 30 (a)
gcy-9 32
  • 30 (a)
gcy-4 32
  • 29 (a)
gcy-23 32
  • 29 (a)
gcy-8 32
  • 28 (a)
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 66 (a)
ManyToMany
-- 31
  • 46 (a)
ManyToMany
Species where no ortholog for NPR1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Tropical Clawed Frog (Silurana tropicalis)
  • Wheat (Triticum aestivum)

Evolution for NPR1 Gene

ENSEMBL:
Gene Tree for NPR1 (if available)
TreeFam:
Gene Tree for NPR1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for NPR1: view image

Paralogs for NPR1 Gene

(15) SIMAP similar genes for NPR1 Gene using alignment to 3 proteins:

  • ANPRA_HUMAN
  • B0ZBF1_HUMAN
  • L8E7A1_HUMAN
genes like me logo Genes that share paralogs with NPR1: view

Variants for NPR1 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for NPR1 Gene

SNP ID Clinical significance and condition Chr 01 pos Variation AA Info Type
711774 Likely Benign: not provided 153,684,954(+) C/T INTRON_VARIANT
711775 Likely Benign: not provided 153,685,093(+) G/A INTRON_VARIANT
714196 Likely Benign: not provided 153,688,205(+) T/C SYNONYMOUS_VARIANT
719343 Benign: not provided 153,686,741(+) G/A SYNONYMOUS_VARIANT
719344 Benign: not provided 153,688,210(+) C/T SYNONYMOUS_VARIANT

Additional dbSNP identifiers (rs#s) for NPR1 Gene

Structural Variations from Database of Genomic Variants (DGV) for NPR1 Gene

Variant ID Type Subtype PubMed ID
dgv582n54 CNV gain 21841781
nsv464028 CNV gain 19166990

Variation tolerance for NPR1 Gene

Residual Variation Intolerance Score: 38% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 7.22; 81.02% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for NPR1 Gene

Human Gene Mutation Database (HGMD)
NPR1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
NPR1

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for NPR1 Gene

Disorders for NPR1 Gene

MalaCards: The human disease database

(9) MalaCards diseases for NPR1 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
hypertensive heart disease
congestive heart failure
  • cardiac failure congestive
cardiac valvular dysplasia, x-linked
  • cvd1
malt worker's lung
  • alveolitis due to aspergillus clavatus
hypertension, essential
  • eht
- elite association - COSMIC cancer census association via MalaCards
Search NPR1 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for NPR1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
genes like me logo Genes that share disorders with NPR1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for NPR1 Gene

Publications for NPR1 Gene

  1. Natriuretic peptide system gene variants are associated with ventricular dysfunction after coronary artery bypass grafting. (PMID: 19326473) Fox AA … Body SC (Anesthesiology 2009) 3 23 41
  2. Multi-ethnic genetic association study of carotid intima-media thickness using a targeted cardiovascular SNP microarray. (PMID: 19679847) Lanktree MB … Anand SS (Stroke 2009) 3 23 41
  3. Association of CT dinucleotide repeat polymorphism in the 5'-flanking region of the guanylyl cyclase (GC)-A gene with essential hypertension in the Japanese. (PMID: 18360023) Usami S … Nakao K (Hypertension research : official journal of the Japanese Society of Hypertension 2008) 3 23 41
  4. Association of renin-angiotensin system and natriuretic peptide receptor A gene polymorphisms with hypertension in a Hellenic population. (PMID: 19126660) Tsezou A … Triposkiadis F (Journal of the renin-angiotensin-aldosterone system : JRAAS 2008) 3 23 41
  5. Genetic polymorphism of the type A human natriuretic peptide receptor (NPR-A) gene contributes to the interindividual variability in the BNP system. (PMID: 18436476) Weber M … Geisslinger G (European journal of heart failure 2008) 3 23 41

Products for NPR1 Gene

Sources for NPR1 Gene