Aliases for NLN Gene
Aliases for NLN Gene
External Ids for NLN Gene
- HGNC: 16058
- Entrez Gene: 57486
- Ensembl: ENSG00000123213
- OMIM: 611530
- UniProtKB: Q9BYT8
Previous HGNC Symbols for NLN Gene
- AGTBP
Previous GeneCards Identifiers for NLN Gene
- GC05P065169
- GC05P066556
- GC05P064988
- GC05P065033
- GC05P065053
- GC05P065018
- GC05P061976
Summaries for NLN Gene
-
This gene encodes a member of the metallopeptidase M3 protein family that cleaves neurotensin at the Pro10-Tyr11 bond, leading to the formation of neurotensin(1-10) and neurotensin(11-13). The encoded protein is likely involved in the termination of the neurotensinergic signal in the central nervous system and in the gastrointestinal tract.[provided by RefSeq, Jun 2010]
GeneCards Summary for NLN Gene
NLN (Neurolysin) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Signaling by GPCR. Gene Ontology (GO) annotations related to this gene include metalloendopeptidase activity and peptide binding. An important paralog of this gene is THOP1.
UniProtKB/Swiss-Prot for NLN Gene
-
Hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A.
Additional gene information for NLN Gene
- Monarch Initiative
- Search for NLN at DataMed
- Search for NLN at HumanCyc
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for NLN Gene
Genomics for NLN Gene
GeneHancer (GH) Regulatory Elements for NLN Gene
Promoters and enhancers for NLN Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around NLN on UCSC Golden Path with GeneCards custom track
- Top Transcription factor binding sites by QIAGEN in the NLN gene promoter:
Regulatory Element Products
Genomic Locations for NLN Gene
Genomic Locations for NLN Gene
- chr5:65,722,196-65,871,725
- (GRCh38/hg38)
- Size:
- 149,530 bases
- Orientation:
- Plus strand
- chr5:65,018,023-65,167,553
- (GRCh37/hg19)
Genomic View for NLN Gene
Genes around NLN on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 5q12.3 by Ensembl
- 5q12.3 by Entrez Gene
- 5q12.3 by HGNC
NLN Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for NLN Gene
Proteins for NLN Gene
-
Protein details for NLN Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9BYT8-NEUL_HUMAN
- Recommended name:
- Neurolysin, mitochondrial
- Protein Accession:
- Q9BYT8
- Q9ULJ4
Protein attributes for NLN Gene
- Size:
- 704 amino acids
- Molecular mass:
- 80652 Da
- Cofactor:
- Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
- Quaternary structure:
- No Data Available
Protein Expression for NLN Gene
Selected DME Specific Peptides for NLN Gene
- Q9BYT8:
-
- LDFPQHVS
- FYLDLYPR
- ASTEADK
- ATPGTNMPATFGHLAGGYD
- DSLRRLSKHY
- FLDDLSQKLKPLGEAEREFIL
- QYYGYLWSEV
- VTYENCLQ
- MEMAFNTRCKEENT
- RNGLHLP
- LQETCDL
- LCIDFNKNLNED
- LSKHYKDG
- YYMTQTEELKYS
- REPNQKAFLMSRGL
- AGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGT
- TLKYPHYFPVMKKCC
- THADFVLE
- NEIKSMKKRMSELCIDFNKNLNEDDT
- KIKPEARRYLEKS
- HAACFGLQPGCL
Post-translational modifications for NLN Gene
Other Protein References for NLN Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for NLN (Neurolysin)
- Novus Biologicals Antibodies for NLN
- Invitrogen Antibodies for NLN
- GeneTex NLN antibody for NLN
-
Santa Cruz Biotechnology (SCBT) Antibodies for NLN
Protein Products
- R&D Systems Proteins and Enzymes for NLN (Neurolysin)
-
OriGene Purified Proteins for NLN
- Search Origene for MassSpec and Protein Over-expression Lysates for NLN
- Origene Custom Protein Services for NLN
- Sino Biological Recombinant Proteins for NLN
- Browse Sino Biological Cell Lysates
- antibodies-online: Search results for 5 available NLN Proteins ranked by validation data
- Compare Top NLN Proteins
-
Quality Products:
- Search GeneTex for Proteins for NLN
-
Abcam proteins for NLN
Assay Products
- antibodies-online: Search results for available NLN related products ranked by validation data
Domains & Families for NLN Gene
Gene Families for NLN Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Plasma proteins
- Predicted intracellular proteins
Protein Domains for NLN Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for NLN Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q9BYT8- Family:
-
- Belongs to the peptidase M3 family.
Function for NLN Gene
Molecular function for NLN Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- Preferential cleavage in neurotensin: 10-Pro- -Tyr-11.
- UniProtKB/Swiss-Prot Function:
- Hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A.
Enzyme Numbers (IUBMB) for NLN Gene
Phenotypes From GWAS Catalog for NLN Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004222 | metalloendopeptidase activity | TAS | -- |
| GO:0008233 | peptidase activity | IEA | -- |
| GO:0008237 | metallopeptidase activity | IEA | -- |
| GO:0016787 | hydrolase activity | IEA | -- |
| GO:0042277 | peptide binding | IEA | -- |
Phenotypes for NLN Gene
- MGI mutant phenotypes for NLN:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for NLN:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Increased shRNA abundance (Z-score > 2)
- Decreased human papilloma virus 16 (HPV16) pseudovirus infection
- Negative genetic interaction between KRASG13D/+ and KRAS+/-
- Increased G1 DNA content
- Decreased shRNA abundance (Z-score < -2)
- Increased shRNA abundance
- Decreased viability
Animal Model Products
-
Taconic Biosciences Mouse Models for NLN
- Cyagen custom Knockout/knockin (KOKI) mouse models for NLN
-
-
ViGene Biosciences lentiviral particle packaged cDNA for NLN gene
-
ViGene Biosciences ready-to-package AAV shRNAs for NLN gene
- Search ViGene Biosciences for NLN
CRISPR Products
-
OriGene CRISPR knockouts for NLN
- genomics-online: gRNA clones - Search results for 117 available NLN gene related products
- Overview of 117 available NLN gene related products
- Applied Biological Materials CRISPR for NLN
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for NLN
- GenScript: Design CRISPR guide RNA sequences for NLN
miRNA for NLN Gene
- miRTarBase miRNAs that target NLN
-
- hsa-mir-16-1-3p (MIRT238581)
- hsa-mir-27a-3p (MIRT238582)
- hsa-mir-27b-3p (MIRT238584)
- hsa-mir-144-3p (MIRT238585)
- hsa-mir-370-5p (MIRT238586)
- hsa-mir-374a-5p (MIRT238587)
- hsa-mir-374b-5p (MIRT238589)
- hsa-mir-627-3p (MIRT472131)
- hsa-mir-216a-3p (MIRT472132)
- hsa-mir-128-3p (MIRT472133)
- hsa-mir-3681-3p (MIRT472134)
- hsa-mir-7152-5p (MIRT535644)
- hsa-mir-3074-5p (MIRT535645)
- hsa-mir-3187-3p (MIRT535646)
- hsa-mir-4435 (MIRT535647)
- hsa-mir-588 (MIRT535648)
- hsa-mir-4701-5p (MIRT535649)
- hsa-mir-548s (MIRT535650)
- hsa-mir-1200 (MIRT535651)
- hsa-mir-378a-5p (MIRT535652)
- hsa-mir-3926 (MIRT535653)
- hsa-mir-5189-3p (MIRT535654)
- hsa-mir-548av-3p (MIRT535655)
- hsa-mir-5582-3p (MIRT535656)
- hsa-mir-548f-3p (MIRT535657)
- hsa-mir-548e-3p (MIRT535658)
- hsa-mir-548az-3p (MIRT535659)
- hsa-mir-548ar-3p (MIRT535660)
- hsa-mir-548a-3p (MIRT535661)
- hsa-mir-6507-3p (MIRT667199)
- hsa-mir-7856-5p (MIRT712336)
- hsa-mir-3658 (MIRT712337)
- hsa-mir-499a-5p (MIRT712338)
- hsa-mir-208b-3p (MIRT712339)
- hsa-mir-208a-3p (MIRT712340)
- hsa-mir-593-3p (MIRT712341)
- hsa-mir-6879-3p (MIRT712342)
- hsa-mir-215-3p (MIRT712343)
- hsa-mir-6773-3p (MIRT712344)
- hsa-mir-500b-3p (MIRT712345)
- hsa-mir-1182 (MIRT712346)
- hsa-mir-4524b-3p (MIRT712347)
- hsa-mir-641 (MIRT712348)
- hsa-mir-3617-5p (MIRT712349)
- hsa-mir-6833-3p (MIRT713381)
- hsa-mir-4768-5p (MIRT713382)
- hsa-mir-6873-3p (MIRT713383)
- hsa-mir-4713-5p (MIRT713384)
- hsa-mir-6817-3p (MIRT713385)
- hsa-mir-7110-3p (MIRT713386)
- hsa-mir-6845-3p (MIRT713387)
- hsa-mir-2116-3p (MIRT713388)
- hsa-mir-26a-2-3p (MIRT713389)
- hsa-mir-26a-1-3p (MIRT713390)
- hsa-mir-193a-5p (MIRT732269)
miRNA Products
- Search ViGene Biosciences for NLN
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for NLN
- Browse OriGene Inhibitory RNA Products For NLN
- genomics-online: shRNA clones - Search results for 117 available NLN gene related products
- Overview of 117 available NLN gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for NLN gene
Clone Products
- Sino Biological Human cDNA Clone for NLN
- VectorBuilder custom plasmid, inducible vectors for NLN
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for NLN
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for NLN
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for NLN
-
ViGene Biosciences adenoviral particle packaged cDNA for NLN gene
-
ViGene Biosciences lentiviral particle packaged cDNA for NLN gene
-
ViGene Biosciences ready-to-package AAV shRNAs for NLN gene
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for NLN Gene
Localization for NLN Gene
Subcellular locations from UniProtKB/Swiss-Prot for NLN Gene
- Mitochondrion intermembrane space. Cytoplasm.
| Compartment | Confidence |
|---|---|
| mitochondrion | 5 |
| extracellular | 4 |
| plasma membrane | 3 |
| cytosol | 3 |
| nucleus | 1 |
- Mitochondria (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005576 | extracellular region | TAS | -- |
| GO:0005737 | cytoplasm | IEA | -- |
| GO:0005739 | mitochondrion | IEA | -- |
| GO:0005758 | mitochondrial intermembrane space | IBA | -- |
| GO:0005886 | plasma membrane | IEA | -- |
Pathways & Interactions for NLN Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Peptide ligand-binding receptors | ||
| 2 | Signaling by GPCR | ||
| 3 | Agents Acting on the Renin-Angiotensin System Pathway, Pharmacodynamics | ||
Pathways by source for NLN Gene
5 Reactome pathways for NLN Gene
1 KEGG pathway for NLN Gene
Interacting Proteins for NLN Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006111 | regulation of gluconeogenesis | IEA | -- |
| GO:0006508 | proteolysis | IEA | -- |
| GO:0006518 | peptide metabolic process | IBA | -- |
| GO:1902809 | regulation of skeletal muscle fiber differentiation | IEA | -- |
No data available for SIGNOR curated interactions for NLN Gene
Drugs & Compounds for NLN Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs |
|---|
Transcripts for NLN Gene
mRNA/cDNA for NLN Gene
- (4) REFSEQ mRNAs :
- (8) Additional mRNA sequences :
- (188) Selected AceView cDNA sequences:
- (10) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for NLN Gene
CRISPR Products
-
OriGene CRISPR knockouts for NLN
- genomics-online: gRNA clones - Search results for 117 available NLN gene related products
- Overview of 117 available NLN gene related products
- Applied Biological Materials CRISPR for NLN
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for NLN
- GenScript: Design CRISPR guide RNA sequences for NLN
miRNA Products
- Search ViGene Biosciences for NLN
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for NLN
- Browse OriGene Inhibitory RNA Products For NLN
- genomics-online: shRNA clones - Search results for 117 available NLN gene related products
- Overview of 117 available NLN gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for NLN gene
Clone Products
- Sino Biological Human cDNA Clone for NLN
- VectorBuilder custom plasmid, inducible vectors for NLN
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for NLN
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for NLN
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
| ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5 | ^ | 6a | · | 6b | ^ | 7 | ^ | 8a | · | 8b | ^ | 9 | ^ | 10a | · | 10b | · | 10c | ^ | 11 | ^ | 12 | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16a | · | 16b | · | 16c |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||
| SP4: | |||||||||||||||||||||||||||||||||||||||||||||
| SP5: | |||||||||||||||||||||||||||||||||||||||||||||
| SP6: | |||||||||||||||||||||||||||||||||||||||||||||
| SP7: |
Expression for NLN Gene
This gene is overexpressed in Brain (35.0) and Fetal Brain (6.5).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for NLN Gene
NURSA nuclear receptor signaling pathways regulating expression of NLN Gene:
NLNSOURCE GeneReport for Unigene cluster for NLN Gene:
Hs.247460Evidence on tissue expression from TISSUES for NLN Gene
- Nervous system(4.7)
- Liver(4.4)
Primer Products
-
OriGene qPCR primer pairs for NLN
-
OriGene qPCR primer pairs and template standards for NLN
- genomics-online: primer clones - Search results for 117 available NLN gene related products
- Overview of 117 available NLN gene related products
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for NLN Gene
Orthologs for NLN Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | NLN 33 34 |
|
||
| dog (Canis familiaris) |
Mammalia | NLN 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | NLN 33 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Nln 33 16 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Nln 33 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | -- 34 |
|
OneToMany | |
| -- 34 |
|
OneToMany | |||
| oppossum (Monodelphis domestica) |
Mammalia | NLN 34 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | NLN 33 34 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | NLN 34 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | nln 33 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | nln 34 |
|
OneToOne | |
| fruit fly (Drosophila melanogaster) |
Insecta | CG11771 35 34 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | ZK550.3 34 |
|
OneToMany | |
| K. lactis yeast (Kluyveromyces lactis) |
Saccharomycetes | KLLA0C00572g 33 |
|
||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | PRD1 33 34 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | CSA.4245 34 |
|
OneToMany | |
| bread mold (Neurospora crassa) |
Ascomycetes | NCU06618 33 |
|
- Species where no ortholog for NLN was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for NLN Gene
(79) SIMAP similar genes for NLN Gene using alignment to 5 proteins:
- DKFZp564F123
- UBE2B
- RRM2B
- NDUFS3
- TUBA1C
- ZNF66
- TMX3
- MRPL45
- RHBG
- SLC24A1
- NDC80
- HEXDC
- SH2B3
- ZNF114
- UBE2V2
- FANCA
- ASCC1
- ZNF554
- TNNT1
- DUSP3
- CALCOCO2
- ACTR10
- FLJ00047
- SIPA1L3
- CNN2
- ZNF257
- LSM12
- C11orf80
- BIRC3
- AAMDC
- THOP1
- SEC14L3
- RQCD1
- ZNF28
- PDILT
- EEF1E1
- DPP9
- SUV420H1
- LDLRAD3
- EIF3G
- GALK2
- HINFP
- GNB2L1
- DYNC2LI1
- COQ5
- RBP7
- ZNF799
- VPS33A
- MMADHC
- IRF2
- ARIH1
- ABI2
- SLC35E3
- RPGRIP1L
- PPP2R5C
- C14orf105
- PFKFB3
- ZNF546
- IDNK
- FRG1
- DOCK8
- TM2D1
- CDK10
- ADCK1
- C12orf76
- ZNF180
- MST132
- RBMS2
- PUS1
- EIF3K
- SEPSECS
- PTPN22
- PPP5D1
- NAE1
- C21orf37
- ATF1
- NLRC5
- TAF2
- FLJ16124
Variants for NLN Gene
| SNP ID | Clin | Chr 05 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1000005800 | -- | 65,825,526(+) | TTTT/TTT | 3_prime_UTR_variant, genic_downstream_transcript_variant | |
| rs1000026857 | -- | 65,736,606(+) | A/G | intron_variant | |
| rs1000058191 | -- | 65,825,914(+) | A/G | 3_prime_UTR_variant, genic_downstream_transcript_variant | |
| rs1000097906 | -- | 65,740,361(+) | T/C | intron_variant | |
| rs1000124969 | -- | 65,809,808(+) | C/T | intron_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv2676386 | CNV | deletion | 23128226 |
| esv2730277 | CNV | deletion | 23290073 |
| esv29005 | CNV | gain | 19812545 |
| esv3566030 | CNV | deletion | 23714750 |
| esv3605303 | CNV | loss | 21293372 |
| nsv507256 | OTHER | sequence alteration | 20534489 |
| nsv820637 | CNV | deletion | 20802225 |
| nsv980652 | CNV | duplication | 23825009 |
Residual Variation Intolerance Score:
26.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
6.42;
77.19% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for NLN Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- NLN
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for NLN Gene
Disorders for NLN Gene
Additional Disease Information for NLN
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No disorders were found for NLN Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for NLN Gene
Publications for NLN Gene
- Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10574462) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1999) 2 3 4 58
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 44 58
- Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson SL … O'Brien SJ (PloS one 2010) 3 44 58
- Swapping the substrate specificities of the neuropeptidases neurolysin and thimet oligopeptidase. (PMID: 17251185) Lim EJ … Rodgers DW (The Journal of biological chemistry 2007) 3 22 58
- Endopeptidases 3.4.24.15 and 24.16 in endothelial cells: potential role in vasoactive peptide metabolism. (PMID: 12609826) Norman MU … Lew RA (American journal of physiology. Heart and circulatory physiology 2003) 3 22 58
Products for NLN Gene
- R&D Systems Antibodies for NLN (Neurolysin)
- R&D Systems Proteins and Enzymes for NLN (Neurolysin)
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for NLN
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for NLN
- Search Origene for MassSpec and Protein Over-expression Lysates for NLN
- Origene Custom Protein Services for NLN
- Origene shrna, sirna, and RNAi products in human, mouse, rat for NLN
- Browse OriGene Inhibitory RNA Products For NLN
- OriGene qPCR primer pairs and template standards for NLN
- OriGene qPCR primer pairs for NLN
- OriGene CRISPR knockouts for NLN
- OriGene ORF clones in human for NLN
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For NLN
- GenScript: Next-day shipping of latest version cDNA ORF clones for NLN in any vector
- GenScript Custom Purified and Recombinant Proteins Services for NLN
- GenScript Custom Assay Services for NLN
- GenScript Custom overexpressing Cell Line Services for NLN
- GenScript: Design CRISPR guide RNA sequences for NLN
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for NLN
- Sino Biological Human cDNA Clone for NLN
- Sino Biological Recombinant Proteins for NLN
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for NLN
- Novus Biologicals lysates and proteins for NLN
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam proteins for NLN
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Taconic Biosciences Mouse Models for NLN
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for NLN
- Cyagen custom Knockout/knockin (KOKI) mouse models for NLN
- VectorBuilder custom plasmid, inducible vectors for NLN
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for NLN
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 30 available NLN Antibodies ranked by validation data
- Compare Top NLN Antibodies
- antibodies-online: Search results for available NLN related products ranked by validation data
- antibodies-online: Search results for 5 available NLN Proteins ranked by validation data
- Compare Top NLN Proteins
- Quality Products:
- GeneTex NLN antibody for NLN
- Search GeneTex for Proteins for NLN
- ViGene Biosciences adenoviral particle packaged cDNA for NLN gene
- ViGene Biosciences lentiviral particle packaged cDNA for NLN gene
- ViGene Biosciences ready-to-package AAV shRNAs for NLN gene
- Search ViGene Biosciences for NLN
- Santa Cruz Biotechnology (SCBT) Antibodies for NLN
- Search Santa Cruz Biotechnology (SCBT) for NLN siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for NLN
- Horizon Cell Lines for NLN
- genomics-online: cdna clones - Search results for 117 available NLN gene related products
- Overview of 117 available NLN gene related products
- orf clones - Search results for 117 available NLN gene related products
- Overview of 117 available NLN gene related products
- genomics-online: gRNA clones - Search results for 117 available NLN gene related products
- Overview of 117 available NLN gene related products
- genomics-online: primer clones - Search results for 117 available NLN gene related products
- Overview of 117 available NLN gene related products
- genomics-online: shRNA clones - Search results for 117 available NLN gene related products
- Overview of 117 available NLN gene related products
Sources for NLN Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew
- (158) Applied Biosystems
