Free for academic non-profit institutions. Other users need a Commercial license
This gene encodes a member of the metallopeptidase M3 protein family that cleaves neurotensin at the Pro10-Tyr11 bond, leading to the formation of neurotensin(1-10) and neurotensin(11-13). The encoded protein is likely involved in the termination of the neurotensinergic signal in the central nervous system and in the gastrointestinal tract.[provided by RefSeq, Jun 2010] See more...
Aliases for NLN Gene
Aliases for NLN Gene
External Ids for NLN Gene
- HGNC: 16058
- Entrez Gene: 57486
- Ensembl: ENSG00000123213
- OMIM: 611530
- UniProtKB: Q9BYT8
Previous HGNC Symbols for NLN Gene
- AGTBP
Previous GeneCards Identifiers for NLN Gene
- GC05P065169
- GC05P066556
- GC05P064988
- GC05P065033
- GC05P065053
- GC05P065018
- GC05P061976
Summaries for NLN Gene
-
This gene encodes a member of the metallopeptidase M3 protein family that cleaves neurotensin at the Pro10-Tyr11 bond, leading to the formation of neurotensin(1-10) and neurotensin(11-13). The encoded protein is likely involved in the termination of the neurotensinergic signal in the central nervous system and in the gastrointestinal tract.[provided by RefSeq, Jun 2010]
GeneCards Summary for NLN Gene
NLN (Neurolysin) is a Protein Coding gene. Diseases associated with NLN include Jackson-Weiss Syndrome. Among its related pathways are Signaling by GPCR and Agents Acting on the Renin-Angiotensin System Pathway, Pharmacodynamics. Gene Ontology (GO) annotations related to this gene include metalloendopeptidase activity and peptide binding. An important paralog of this gene is THOP1.
UniProtKB/Swiss-Prot Summary for NLN Gene
-
Hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A.
Additional gene information for NLN Gene
- HGNC(16058)
- Entrez Gene(57486)
- Ensembl(ENSG00000123213)
- OMIM(611530)
- UniProtKB(Q9BYT8)
- Open Targets Platform(ENSG00000123213)
- Monarch Initiative
- Search for NLN at DataMed
- Search for NLN at HumanCyc
No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for NLN Gene
Genomics for NLN Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for NLN Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around NLN on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for NLN
- Top Transcription factor binding sites by QIAGEN in the NLN gene promoter:
-
- c-Myc
- E47
- GR
- GR-alpha
- Lmo2
- Max
- STAT1
- STAT1alpha
- STAT1beta
Genomic Locations for NLN Gene
Genomic Locations for NLN Gene
- chr5:65,722,205-65,871,725
- (GRCh38/hg38)
- Size:
- 149,521 bases
- Orientation:
- Plus strand
- chr5:65,018,023-65,167,553
- (GRCh37/hg19)
- Size:
- 149,531 bases
- Orientation:
- Plus strand
Genomic View for NLN Gene
Genes around NLN on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 5q12.3 by HGNC
- 5q12.3 by Entrez Gene
- 5q12.3 by Ensembl
NLN Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for NLN Gene
Proteins for NLN Gene
-
Protein details for NLN Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9BYT8-NEUL_HUMAN
- Recommended name:
- Neurolysin, mitochondrial
- Protein Accession:
- Q9BYT8
- Q9ULJ4
Protein attributes for NLN Gene
- Size:
- 704 amino acids
- Molecular mass:
- 80652 Da
- Cofactor:
- Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
- Quaternary structure:
- No Data Available
Protein Expression for NLN Gene
Selected DME Specific Peptides for NLN Gene
- Q9BYT8:
-
- LDFPQHVS
- FYLDLYPR
- ASTEADK
- ATPGTNMPATFGHLAGGYD
- DSLRRLSKHY
- FLDDLSQKLKPLGEAEREFIL
- QYYGYLWSEV
- VTYENCLQ
- MEMAFNTRCKEENT
- RNGLHLP
- LQETCDL
- LCIDFNKNLNED
- LSKHYKDG
- YYMTQTEELKYS
- REPNQKAFLMSRGL
- AGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGT
- TLKYPHYFPVMKKCC
- THADFVLE
- NEIKSMKKRMSELCIDFNKNLNEDDT
- KIKPEARRYLEKS
- HAACFGLQPGCL
Post-translational modifications for NLN Gene
Other Protein References for NLN Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Creative Diagnostics Anti-NLN monoclonal antibody, clone 2C9
- Novus Biologicals Antibodies for NLN
- Invitrogen Antibodies for NLN (AFLGC-Nln)
-
Biorbyt antibodies for NLN
-
Santa Cruz Biotechnology (SCBT) Antibodies for NLN
- Sino Biological Antibodies for NLN
Protein Products
- Search Origene for MassSpec and Protein Over-expression Lysates for NLN
- Origene Custom Protein Services for NLN
- Sino Biological Recombinant Proteins for NLN
- Browse Sino Biological Cell Lysates
- antibodies-online: Show 5 available NLN Proteins ranked by validation data
- Compare Top NLN Proteins
-
Quality Products:
-
Abcam proteins for NLN
Domains & Families for NLN Gene
Gene Families for NLN Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Plasma proteins
- Predicted intracellular proteins
Protein Domains for NLN Gene
- InterPro:
- Blocks:
-
- Peptidase M3
- ProtoNet:
Suggested Antigen Peptide Sequences for NLN Gene
- GenScript: Design optimal peptide antigens:
-
- Neurotensin endopeptidase (NEUL_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q9BYT8- Family:
-
- Belongs to the peptidase M3 family.
Function for NLN Gene
Molecular function for NLN Gene
- UniProtKB/Swiss-Prot Function:
- Hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=Preferential cleavage in neurotensin: 10-Pro-|-Tyr-11.; EC=3.4.24.16;.
Enzyme Numbers (IUBMB) for NLN Gene
Phenotypes From GWAS Catalog for NLN Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004222 | metalloendopeptidase activity | IEA,TAS | -- |
| GO:0008233 | peptidase activity | IEA | -- |
| GO:0008237 | metallopeptidase activity | IEA | -- |
| GO:0016787 | hydrolase activity | IEA | -- |
| GO:0042277 | peptide binding | IEA | -- |
Phenotypes for NLN Gene
- MGI mutant phenotypes for NLN:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for NLN:
-
- Increased vaccinia virus (VACV) infection
- no effect
- Decreased viability
- shRNA abundance <= 50%
- Negative genetic interaction between KRASG13D/+ and KRAS+/-
- shRNA abundance <= 25%
- Decreased human papilloma virus 16 (HPV16) pseudovirus infection
- Increased shRNA abundance
- Decreased shRNA abundance (Z-score < -2)
- Increased shRNA abundance (Z-score > 2)
- Increased G2M DNA content
Animal Model Products
-
Taconic Biosciences Mouse Models for NLN
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for NLN - Select products 50% OFF >
- * NLN CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for NLN
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for NLN
-
Santa Cruz Biotechnology (SCBT) CRISPR for NLN
miRNA for NLN Gene
- miRTarBase miRNAs that target NLN
-
- hsa-miR-16-1-3p (MIRT238581)
- hsa-miR-27a-3p (MIRT238582)
- hsa-miR-27b-3p (MIRT238584)
- hsa-miR-144-3p (MIRT238585)
- hsa-miR-370-5p (MIRT238586)
- hsa-miR-374a-5p (MIRT238587)
- hsa-miR-374b-5p (MIRT238589)
- hsa-miR-627-3p (MIRT472131)
- hsa-miR-216a-3p (MIRT472132)
- hsa-miR-128-3p (MIRT472133)
- hsa-miR-3681-3p (MIRT472134)
- hsa-miR-7152-5p (MIRT535644)
- hsa-miR-3074-5p (MIRT535645)
- hsa-miR-3187-3p (MIRT535646)
- hsa-miR-4435 (MIRT535647)
- hsa-miR-588 (MIRT535648)
- hsa-miR-4701-5p (MIRT535649)
- hsa-miR-548s (MIRT535650)
- hsa-miR-1200 (MIRT535651)
- hsa-miR-378a-5p (MIRT535652)
- hsa-miR-3926 (MIRT535653)
- hsa-miR-5189-3p (MIRT535654)
- hsa-miR-548av-3p (MIRT535655)
- hsa-miR-5582-3p (MIRT535656)
- hsa-miR-548f-3p (MIRT535657)
- hsa-miR-548e-3p (MIRT535658)
- hsa-miR-548az-3p (MIRT535659)
- hsa-miR-548ar-3p (MIRT535660)
- hsa-miR-548a-3p (MIRT535661)
- mmu-miR-410-3p (MIRT582156)
- mmu-miR-344e-3p (MIRT582157)
- mmu-miR-344d-3p (MIRT582158)
- mmu-miR-466d-3p (MIRT582159)
- mmu-miR-466a-3p (MIRT582160)
- mmu-miR-297b-3p (MIRT582161)
- mmu-miR-466e-3p (MIRT582162)
- mmu-miR-467g (MIRT582163)
- mmu-miR-376c-3p (MIRT582164)
- mmu-miR-3060-3p (MIRT582165)
- hsa-miR-6507-3p (MIRT667199)
- hsa-miR-7856-5p (MIRT712336)
- hsa-miR-3658 (MIRT712337)
- hsa-miR-499a-5p (MIRT712338)
- hsa-miR-208b-3p (MIRT712339)
- hsa-miR-208a-3p (MIRT712340)
- hsa-miR-593-3p (MIRT712341)
- hsa-miR-6879-3p (MIRT712342)
- hsa-miR-215-3p (MIRT712343)
- hsa-miR-6773-3p (MIRT712344)
- hsa-miR-500b-3p (MIRT712345)
- hsa-miR-1182 (MIRT712346)
- hsa-miR-4524b-3p (MIRT712347)
- hsa-miR-641 (MIRT712348)
- hsa-miR-3617-5p (MIRT712349)
- hsa-miR-6833-3p (MIRT713381)
- hsa-miR-4768-5p (MIRT713382)
- hsa-miR-6873-3p (MIRT713383)
- hsa-miR-4713-5p (MIRT713384)
- hsa-miR-6817-3p (MIRT713385)
- hsa-miR-7110-3p (MIRT713386)
- hsa-miR-6845-3p (MIRT713387)
- hsa-miR-2116-3p (MIRT713388)
- hsa-miR-26a-2-3p (MIRT713389)
- hsa-miR-26a-1-3p (MIRT713390)
- hsa-miR-193a-5p (MIRT732269)
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for NLN
- Browse OriGene Inhibitory RNA Products For NLN
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for NLN
Clone Products
- Applied Biological Materials (abm): Clones for NLN - Select products 50% OFF >
- * NLN as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for NLN
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for NLN
Cell Line Products
-
Horizon Cell Lines for NLN
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for NLN Gene
Localization for NLN Gene
Subcellular locations from UniProtKB/Swiss-Prot for NLN Gene
- Mitochondrion intermembrane space. Cytoplasm.
| Compartment | Confidence |
|---|---|
| extracellular | 4 |
| mitochondrion | 4 |
| plasma membrane | 3 |
| cytosol | 3 |
| nucleus | 2 |
| cytoskeleton | 1 |
| endoplasmic reticulum | 1 |
| endosome | 1 |
| lysosome | 1 |
| golgi apparatus | 1 |
- Mitochondria (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005576 | extracellular region | TAS | -- |
| GO:0005737 | cytoplasm | IEA | -- |
| GO:0005739 | mitochondrion | IEA | -- |
| GO:0005758 | mitochondrial intermembrane space | IBA | 21873635 |
| GO:0005886 | plasma membrane | IEA | -- |
Pathways & Interactions for NLN Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Peptide ligand-binding receptors | ||
| 2 | Signaling by GPCR | ||
| 3 | Agents Acting on the Renin-Angiotensin System Pathway, Pharmacodynamics | ||
Pathways by source for NLN Gene
5 Reactome pathways for NLN Gene
1 KEGG pathway for NLN Gene
Interacting Proteins for NLN Gene
GPS-Prot Interaction Network for NLN
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006111 | regulation of gluconeogenesis | IEA | -- |
| GO:0006508 | proteolysis | IEA,IBA | 21873635 |
| GO:0006518 | peptide metabolic process | IBA | 21873635 |
| GO:1902809 | regulation of skeletal muscle fiber differentiation | IEA | -- |
No data available for SIGNOR curated interactions for NLN Gene
Drugs & Compounds for NLN Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs |
|---|
Transcripts for NLN Gene
mRNA/cDNA for NLN Gene
- 1 REFSEQ mRNAs :
- 11 NCBI additional mRNA sequence :
- 10 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000380985 8652 nts (view in UCSC)
- ENST00000502464 8354 nts (view in UCSC)
- ENST00000506539 2637 nts (view in UCSC)
- ENST00000506677 701 nts (view in UCSC)
- ENST00000506799 2085 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for NLN - Select products 50% OFF >
- * NLN CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for NLN
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for NLN
-
Santa Cruz Biotechnology (SCBT) CRISPR for NLN
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for NLN
- Browse OriGene Inhibitory RNA Products For NLN
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for NLN
Clone Products
- Applied Biological Materials (abm): Clones for NLN - Select products 50% OFF >
- * NLN as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for NLN
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for NLN
| ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5 | ^ | 6a | · | 6b | ^ | 7 | ^ | 8a | · | 8b | ^ | 9 | ^ | 10a | · | 10b | · | 10c | ^ | 11 | ^ | 12 | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16a | · | 16b | · | 16c |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||
| SP4: | |||||||||||||||||||||||||||||||||||||||||||||
| SP5: | |||||||||||||||||||||||||||||||||||||||||||||
| SP6: | |||||||||||||||||||||||||||||||||||||||||||||
| SP7: |
Relevant External Links for NLN Gene
- GeneLoc Exon Structure for
- NLN
Expression for NLN Gene
This gene is overexpressed in Brain (35.0) and Fetal Brain (6.5).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for NLN Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for NLN
SOURCE GeneReport for Unigene cluster for NLN Gene:
Hs.247460Evidence on tissue expression from TISSUES for NLN Gene
- Nervous system(4.7)
- Liver(4.5)
- Blood(2.2)
- Heart(2.1)
- Skin(2.1)
- Kidney(2.1)
- Lymph node(2)
- Muscle(2)
Primer Products
-
OriGene qPCR primer pairs for NLN
-
OriGene qPCR primer pairs and template standards for NLN
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for NLN Gene
Orthologs for NLN Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | NLN 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | NLN 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | NLN 30 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Nln 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Nln 30 |
|
||
| Platypus (Ornithorhynchus anatinus) |
Mammalia | -- 31 |
|
OneToMany | |
| -- 31 |
|
OneToMany | |||
| Oppossum (Monodelphis domestica) |
Mammalia | NLN 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | NLN 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | NLN 31 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | nln 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | nln 31 |
|
OneToOne | |
| Fruit Fly (Drosophila melanogaster) |
Insecta | CG11771 31 32 |
|
OneToMany | |
| Worm (Caenorhabditis elegans) |
Secernentea | ZK550.3 31 |
|
OneToMany | |
| K. Lactis Yeast (Kluyveromyces lactis) |
Saccharomycetes | KLLA0C00572g 30 |
|
||
| Baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | PRD1 30 31 |
|
OneToMany | |
| Sea Squirt (Ciona savignyi) |
Ascidiacea | CSA.4245 31 |
|
OneToMany | |
| Bread mold (Neurospora crassa) |
Ascomycetes | NCU06618 30 |
|
- Species where no ortholog for NLN was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for NLN Gene
- ENSEMBL:
- Gene Tree for NLN (if available)
- TreeFam:
- Gene Tree for NLN (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for NLN: view image
Paralogs for NLN Gene
(79) SIMAP similar genes for NLN Gene using alignment to 5 proteins:
- NEUL_HUMAN
- D6R9Y0_HUMAN
- E9PCB6_HUMAN
- H0YAF7_HUMAN
- H0YAK4_HUMAN
- DKFZp564F123
- UBE2B
- RRM2B
- NDUFS3
- TUBA1C
- ZNF66
- TMX3
- MRPL45
- RHBG
- SLC24A1
- NDC80
- HEXDC
- SH2B3
- ZNF114
- UBE2V2
- FANCA
- ASCC1
- ZNF554
- TNNT1
- DUSP3
- CALCOCO2
- ACTR10
- FLJ00047
- SIPA1L3
- CNN2
- ZNF257
- LSM12
- C11orf80
- BIRC3
- AAMDC
- THOP1
- SEC14L3
- RQCD1
- ZNF28
- PDILT
- EEF1E1
- DPP9
- SUV420H1
- LDLRAD3
- EIF3G
- GALK2
- HINFP
- GNB2L1
- DYNC2LI1
- COQ5
- RBP7
- ZNF799
- VPS33A
- MMADHC
- IRF2
- ARIH1
- ABI2
- SLC35E3
- RPGRIP1L
- PPP2R5C
- C14orf105
- PFKFB3
- ZNF546
- IDNK
- FRG1
- DOCK8
- TM2D1
- CDK10
- ADCK1
- C12orf76
- ZNF180
- MST132
- RBMS2
- PUS1
- EIF3K
- SEPSECS
- PTPN22
- PPP5D1
- NAE1
- C21orf37
- ATF1
- NLRC5
- TAF2
- FLJ16124
Variants for NLN Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for NLN Gene
| SNP ID | Clinical significance and condition | Chr 05 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| 769299 | Benign: not provided | 65,792,660(+) | GT/G | INTRON_VARIANT | |
| rs2289884 | - | p.Ser417Gly | |||
| rs34063558 | - | p.Ser323Gly | |||
| rs34339013 | - | p.Gly79Ser | |||
| rs6860508 | - | p.Pro704Ser |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv2676386 | CNV | deletion | 23128226 |
| esv2730277 | CNV | deletion | 23290073 |
| esv29005 | CNV | gain | 19812545 |
| esv3566030 | CNV | deletion | 23714750 |
| esv3605303 | CNV | loss | 21293372 |
| nsv507256 | OTHER | sequence alteration | 20534489 |
| nsv820637 | CNV | deletion | 20802225 |
| nsv980652 | CNV | duplication | 23825009 |
Residual Variation Intolerance Score:
26.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
6.42;
77.19% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for NLN Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- NLN
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for NLN Gene
Disorders for NLN Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| jackson-weiss syndrome |
|
|
Search NLN in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for NLN
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for NLN Gene
Publications for NLN Gene
- Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10574462) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1999) 2 3 4
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 41
- Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson SL … O'Brien SJ (PloS one 2010) 3 41
- Swapping the substrate specificities of the neuropeptidases neurolysin and thimet oligopeptidase. (PMID: 17251185) Lim EJ … Rodgers DW (The Journal of biological chemistry 2007) 3 23
- Endopeptidases 3.4.24.15 and 24.16 in endothelial cells: potential role in vasoactive peptide metabolism. (PMID: 12609826) Norman MU … Lew RA (American journal of physiology. Heart and circulatory physiology 2003) 3 23
ExternalLinks
Products for NLN Gene
- Custom Antibody ServicesOriGene Antibodies for NLN
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for NLN
- Origene Custom Protein Services for NLN
- Origene shrna, sirna, and RNAi products in human, mouse, rat for NLN
- Browse OriGene Inhibitory RNA Products For NLN
- OriGene qPCR primer pairs for NLN
- OriGene qPCR primer pairs and template standards for NLN
- OriGene CRISPR knockouts for NLN
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For NLN
- Sino Biological Human cDNA Clone for NLN
- Sino Biological Recombinant Proteins for NLN
- Browse Sino Biological Cell Lysates
- Sino Biological Antibodies for NLN
- Browse Sino Biological Assays
- Browse Recombinant Proteins
- Browse Antibodies
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for NLN
- Novus Biologicals proteins and lysates for NLN
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam proteins for NLN
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Taconic Biosciences Mouse Models for NLN
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for NLN (AFLGC-Nln)
- VectorBuilder Custom and pre-made DNA vectors for NLN (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for NLN (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for NLN (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for NLN CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for NLN
- antibodies-online: Show 26 available NLN Antibodies ranked by validation data
- Compare Top NLN Antibodies
- antibodies-online: Search results for available NLN related products ranked by validation data
- antibodies-online: Show 5 available NLN Proteins ranked by validation data
- Compare Top NLN Proteins
- Quality Products:
- Santa Cruz Biotechnology (SCBT) Antibodies for NLN
- Search Santa Cruz Biotechnology (SCBT) for NLN siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for NLN
- Horizon Cell Lines for NLN
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for NLN
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for NLN
- Search GeneCopoeia for miRNA 3'UTR Target clone products for NLN
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for NLN
- Biorbyt antibodies for NLN
Sources for NLN Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177) snoDB
- (178) MirGeneDB