This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved in many important biological processes, inclu... See more...

Aliases for NAMPT Gene

Aliases for NAMPT Gene

  • Nicotinamide Phosphoribosyltransferase 2 3 4 5
  • Pre-B-Cell Colony-Enhancing Factor 1 3 4
  • Pre-B Cell-Enhancing Factor 3 4
  • EC 2.4.2.12 4 54
  • NAmPRTase 3 4
  • Visfatin 2 4
  • PBEF1 3 4
  • PBEF 3 4
  • Pre-B-Cell Colony Enhancing Factor 1 2
  • 1110035O14Rik 3
  • VISFATIN 3
  • Nampt 4
  • VF 3

External Ids for NAMPT Gene

Previous HGNC Symbols for NAMPT Gene

  • PBEF1

Previous GeneCards Identifiers for NAMPT Gene

  • GC07M105675
  • GC07M105888
  • GC07M100248

Summaries for NAMPT Gene

Entrez Gene Summary for NAMPT Gene

  • This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved in many important biological processes, including metabolism, stress response and aging. This gene has a pseudogene on chromosome 10. [provided by RefSeq, Feb 2011]

GeneCards Summary for NAMPT Gene

NAMPT (Nicotinamide Phosphoribosyltransferase) is a Protein Coding gene. Diseases associated with NAMPT include Aging and Gestational Diabetes. Among its related pathways are NOD-like receptor signaling pathway and NAD metabolism. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and drug binding. An important paralog of this gene is NAPRT.

UniProtKB/Swiss-Prot Summary for NAMPT Gene

  • Catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD. It is the rate limiting component in the mammalian NAD biosynthesis pathway. The secreted form behaves both as a cytokine with immunomodulating properties and an adipokine with anti-diabetic properties, it has no enzymatic activity, partly because of lack of activation by ATP, which has a low level in extracellular space and plasma. Plays a role in the modulation of circadian clock function. NAMPT-dependent oscillatory production of NAD regulates oscillation of clock target gene expression by releasing the core clock component: CLOCK-ARNTL/BMAL1 heterodimer from NAD-dependent SIRT1-mediated suppression (By similarity).

Tocris Summary for NAMPT Gene

  • Nicotinamide phosphoribosyltransferase (NAMPT), EC 2.4.2.12, is an enzyme that catalyzes the transfer of a phosphoribosyl group from 5-phosphoribosyl-1-pyrophosphate (PRPP) to nicotinamide, forming nicotinamide mononucleotide (NMN) a key NAD pathway intermediate.

Gene Wiki entry for NAMPT Gene

Additional gene information for NAMPT Gene

No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for NAMPT Gene

Genomics for NAMPT Gene

GeneHancer (GH) Regulatory Elements for NAMPT Gene

Promoters and enhancers for NAMPT Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around NAMPT on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the NAMPT gene promoter:
  • AP-1
  • ATF-2
  • c-Jun
  • c-Myc
  • Max
  • Nkx3-1
  • Nkx3-1 v1
  • Nkx3-1 v2
  • Nkx3-1 v3
  • Nkx3-1 v4

Genomic Locations for NAMPT Gene

Genomic Locations for NAMPT Gene
chr7:106,248,285-106,286,326
(GRCh38/hg38)
Size:
38,042 bases
Orientation:
Minus strand
chr7:105,888,731-105,926,772
(GRCh37/hg19)
Size:
38,042 bases
Orientation:
Minus strand

Genomic View for NAMPT Gene

Genes around NAMPT on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
NAMPT Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for NAMPT Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for NAMPT Gene

Proteins for NAMPT Gene

  • Protein details for NAMPT Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P43490-NAMPT_HUMAN
    Recommended name:
    Nicotinamide phosphoribosyltransferase
    Protein Accession:
    P43490
    Secondary Accessions:
    • A4D0Q9
    • A4D0R0
    • Q3KQV0
    • Q8WW95

    Protein attributes for NAMPT Gene

    Size:
    491 amino acids
    Molecular mass:
    55521 Da
    Quaternary structure:
    • Homodimer.
    SequenceCaution:
    • Sequence=AAQ96862.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=EAL24400.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for NAMPT Gene

neXtProt entry for NAMPT Gene

Selected DME Specific Peptides for NAMPT Gene

P43490:
  • ALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEH
  • DLLHTVFKNGKVTKSYSFDE
  • RKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAK
  • AAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKK
  • VIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVAT
  • APLIIRPDSGNPLDTVLKVL

Post-translational modifications for NAMPT Gene

  • Ubiquitination at Lys99, Lys189, Lys342, and Lys371
  • Modification sites at PhosphoSitePlus

Other Protein References for NAMPT Gene

Antibody Products

  • Boster Bio Antibodies for NAMPT

Protein Products

Domains & Families for NAMPT Gene

Gene Families for NAMPT Gene

Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for NAMPT Gene

GenScript: Design optimal peptide antigens:
  • Visfatin (NAMPT_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P43490

UniProtKB/Swiss-Prot:

NAMPT_HUMAN :
  • Belongs to the NAPRTase family.
Family:
  • Belongs to the NAPRTase family.
genes like me logo Genes that share domains with NAMPT: view

Function for NAMPT Gene

Molecular function for NAMPT Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD. It is the rate limiting component in the mammalian NAD biosynthesis pathway. The secreted form behaves both as a cytokine with immunomodulating properties and an adipokine with anti-diabetic properties, it has no enzymatic activity, partly because of lack of activation by ATP, which has a low level in extracellular space and plasma. Plays a role in the modulation of circadian clock function. NAMPT-dependent oscillatory production of NAD regulates oscillation of clock target gene expression by releasing the core clock component: CLOCK-ARNTL/BMAL1 heterodimer from NAD-dependent SIRT1-mediated suppression (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=beta-nicotinamide D-ribonucleotide + diphosphate = 5-phospho-alpha-D-ribose 1-diphosphate + H(+) + nicotinamide; Xref=Rhea:RHEA:16149, ChEBI:CHEBI:14649, ChEBI:CHEBI:15378, ChEBI:CHEBI:17154, ChEBI:CHEBI:33019, ChEBI:CHEBI:58017; EC=2.4.2.12;.
UniProtKB/Swiss-Prot EnzymeRegulation:
Inhibited by FK866. FK866 competes for the same binding site as nicotinamide, but due to its very low dissociation rate, it is essentially an irreversible inhibitor.

Enzyme Numbers (IUBMB) for NAMPT Gene

Phenotypes From GWAS Catalog for NAMPT Gene

Gene Ontology (GO) - Molecular Function for NAMPT Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003824 catalytic activity IEA --
GO:0004514 nicotinate-nucleotide diphosphorylase (carboxylating) activity IEA --
GO:0005125 cytokine activity IEA,TAS --
GO:0005515 protein binding IPI 18486613
GO:0008144 drug binding IEA --
genes like me logo Genes that share ontologies with NAMPT: view
genes like me logo Genes that share phenotypes with NAMPT: view

Animal Models for NAMPT Gene

MGI Knock Outs for NAMPT:
  • Nampt Nampt<tm1.1(KOMP)Vlcg>

Animal Model Products

  • Taconic Biosciences Mouse Models for NAMPT

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for NAMPT

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for NAMPT Gene

Localization for NAMPT Gene

Subcellular locations from UniProtKB/Swiss-Prot for NAMPT Gene

Nucleus. Cytoplasm. Secreted. Note=Under non-inflammatory conditions, visfatin predominantly exhibits a granular pattern within the nucleus. Secreted by endothelial cells upon IL-1beta stimulation. Abundantly secreted in milk, reaching 100-fold higher concentrations compared to maternal serum. {ECO:0000269 PubMed:21741723, ECO:0000269 PubMed:24130902}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for NAMPT gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 3
extracellular 2
mitochondrion 2
peroxisome 2
cytoskeleton 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cell Junctions (2)
  • Nuclear speckles (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for NAMPT Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region IEA --
GO:0005615 extracellular space IEA --
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with NAMPT: view

Pathways & Interactions for NAMPT Gene

genes like me logo Genes that share pathways with NAMPT: view

UniProtKB/Swiss-Prot P43490-NAMPT_HUMAN

  • Pathway: Cofactor biosynthesis; NAD(+) biosynthesis; nicotinamide D-ribonucleotide from 5-phospho-alpha-D-ribose 1-diphosphate and nicotinamide: step 1/1.

SIGNOR curated interactions for NAMPT Gene

Is activated by:

Gene Ontology (GO) - Biological Process for NAMPT Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001774 microglial cell activation IEA --
GO:0007165 signal transduction TAS 8289818
GO:0007267 cell-cell signaling TAS 8289818
GO:0007565 female pregnancy IEA --
GO:0007568 aging IEA --
genes like me logo Genes that share ontologies with NAMPT: view

Drugs & Compounds for NAMPT Gene

(38) Drugs for NAMPT Gene - From: DrugBank, ClinicalTrials, ApexBio, DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Nicotinamide Approved, Investigational Pharma 519,519
Niacin Approved, Investigational Nutra Unknown, Agonist, Full agonist 523,523
Folic acid Approved, Vet_approved Nutra 4687
Phosphoric acid Approved Pharma 0
NAD Experimental Pharma Full agonist, Agonist, Activator 0

(14) Additional Compounds for NAMPT Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
beta-nicotinamide D-ribonucleotide
Nicotinamide ribotide
  • 3-(Aminocarbonyl)-1-(5-O-phosphonato-beta-D-ribofuranosyl)pyridinium
  • 3-(Aminocarbonyl)-1-(5-O-phosphono-beta-D-ribofuranosyl)pyridinium, inner salt
  • beta-Nicotinamide D-ribonucleotide
  • beta-Nicotinamide mononucleotide
  • beta-Nicotinamide ribonucleotide
1094-61-7
Phosphoribosyl pyrophosphate
  • 5-phospho-alpha-D-Ribose 1-diphosphate
  • 5-Phosphoribosyl 1-pyrophosphate
  • 5-Phosphoribosyl diphosphate
  • alpha-D-Ribofuranose 5-(dihydrogen phosphate) 1-(trihydrogen diphosphate)
  • ALPHA-PHOSPHORIBOSYLPYROphosphORIC ACID
7540-64-9
pyrophosphate
  • [(ho)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • PYROphosphATE
14000-31-8

(9) ApexBio Compounds for NAMPT Gene

Compound Action Cas Number
CB 300919 Potential therapy for ovarian cancer 289715-28-2
CB30865 Nampt inhibitor 206275-15-2
FK 866 hydrochloride NMPRTase inhibitor
FK866 (APO866) NAMPT inhibitor,non-competitive, highly specific 658084-64-1
GMX1778 (CHS828) NAMPT inhibitor 200484-11-3
GNE-617 NAMPT inhibitor 1362154-70-8
GNE-617 hydrochloride NAMPT inhibitor, potent and competitive
GPP 78 hydrochloride
STF-118804 NAMPT inhibitor 894187-61-2
genes like me logo Genes that share compounds with NAMPT: view

Transcripts for NAMPT Gene

mRNA/cDNA for NAMPT Gene

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for NAMPT

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for NAMPT Gene

No ASD Table

Relevant External Links for NAMPT Gene

GeneLoc Exon Structure for
NAMPT
ECgene alternative splicing isoforms for
NAMPT

Expression for NAMPT Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for NAMPT Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for NAMPT Gene

This gene is overexpressed in Whole Blood (x18.5).

Protein differential expression in normal tissues from HIPED for NAMPT Gene

This gene is overexpressed in Lavage (9.1) and Islet of Langerhans (6.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for NAMPT Gene



Protein tissue co-expression partners for NAMPT Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of NAMPT Gene:

NAMPT

SOURCE GeneReport for Unigene cluster for NAMPT Gene:

Hs.489615

mRNA Expression by UniProt/SwissProt for NAMPT Gene:

P43490-NAMPT_HUMAN
Tissue specificity: Expressed in large amounts in bone marrow, liver tissue, and muscle. Also present in heart, placenta, lung, and kidney tissues.

Evidence on tissue expression from TISSUES for NAMPT Gene

  • Blood(4.9)
  • Lung(4.9)
  • Liver(4.8)
  • Skin(4.5)
  • Nervous system(4.4)
  • Heart(3.3)
  • Intestine(3)
  • Muscle(3)
  • Kidney(2.9)
  • Pancreas(2.8)
  • Bone marrow(2.6)
  • Spleen(2.5)
genes like me logo Genes that share expression patterns with NAMPT: view

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for NAMPT Gene

Orthologs for NAMPT Gene

This gene was present in the common ancestor of chordates.

Orthologs for NAMPT Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia NAMPT 33 32
  • 99.66 (n)
OneToOne
cow
(Bos Taurus)
Mammalia NAMPT 33 32
  • 94.7 (n)
OneToMany
dog
(Canis familiaris)
Mammalia NAMPT 32
  • 93.44 (n)
-- 33
  • 92 (a)
OneToMany
platypus
(Ornithorhynchus anatinus)
Mammalia -- 33
  • 92 (a)
OneToMany
mouse
(Mus musculus)
Mammalia Nampt 17 33 32
  • 91.38 (n)
rat
(Rattus norvegicus)
Mammalia Nampt 32
  • 89.82 (n)
oppossum
(Monodelphis domestica)
Mammalia -- 33
  • 81 (a)
OneToMany
chicken
(Gallus gallus)
Aves PBEF1 33
  • 94 (a)
OneToMany
NAMPT 32
  • 84.43 (n)
lizard
(Anolis carolinensis)
Reptilia -- 33
  • 90 (a)
OneToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia nampt 32
  • 78.51 (n)
Str.8198 32
African clawed frog
(Xenopus laevis)
Amphibia LOC398502 32
zebrafish
(Danio rerio)
Actinopterygii nampta 33
  • 86 (a)
ManyToMany
BX248331.2 33
  • 78 (a)
ManyToMany
CT033790.1 33
  • 78 (a)
ManyToMany
CT033790.3 33
  • 78 (a)
ManyToMany
LOC100330160 32
  • 74.02 (n)
namptb 33
  • 59 (a)
ManyToMany
si:dkey-145c18.3 33
  • 52 (a)
ManyToMany
si:dkey-145c18.2 33
  • 39 (a)
ManyToMany
Dr.8694 32
Species where no ortholog for NAMPT was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for NAMPT Gene

ENSEMBL:
Gene Tree for NAMPT (if available)
TreeFam:
Gene Tree for NAMPT (if available)
Aminode:
Evolutionary constrained regions (ECRs) for NAMPT: view image

Paralogs for NAMPT Gene

Paralogs for NAMPT Gene

(1) SIMAP similar genes for NAMPT Gene using alignment to 3 proteins:

  • NAMPT_HUMAN
  • C9JF35_HUMAN
  • C9JG65_HUMAN

Pseudogenes.org Pseudogenes for NAMPT Gene

genes like me logo Genes that share paralogs with NAMPT: view

Variants for NAMPT Gene

Sequence variations from dbSNP and Humsavar for NAMPT Gene

SNP ID Clin Chr 07 pos Variation AA Info Type
VAR_036614 A colorectal cancer sample p.Leu176Ser
rs1000049205 -- 106,281,222(-) A/T intron_variant
rs1000138635 -- 106,262,378(-) A/G intron_variant
rs1000154597 -- 106,276,424(-) A/G intron_variant
rs1000183552 -- 106,286,749(-) G/A upstream_transcript_variant

Structural Variations from Database of Genomic Variants (DGV) for NAMPT Gene

Variant ID Type Subtype PubMed ID
nsv1027213 CNV gain 25217958
nsv1074543 CNV deletion 25765185
nsv475946 CNV novel sequence insertion 20440878
nsv970929 CNV duplication 23825009

Variation tolerance for NAMPT Gene

Residual Variation Intolerance Score: 46.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.46; 10.08% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for NAMPT Gene

Human Gene Mutation Database (HGMD)
NAMPT
SNPedia medical, phenotypic, and genealogical associations of SNPs for
NAMPT

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for NAMPT Gene

Disorders for NAMPT Gene

MalaCards: The human disease database

(10) MalaCards diseases for NAMPT Gene - From: HGMD, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
aging
gestational diabetes
  • gdm
idiopathic recurrent pericarditis
  • idiopathic relapsing pericarditis
body mass index quantitative trait locus 11
  • bmiq11
tuberculum sellae meningioma
  • meningioma of the tuberculum sellae
- elite association - COSMIC cancer census association via MalaCards
Search NAMPT in MalaCards View complete list of genes associated with diseases

Additional Disease Information for NAMPT

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with NAMPT: view

No data available for UniProtKB/Swiss-Prot and Genatlas for NAMPT Gene

Publications for NAMPT Gene

  1. Cloning and characterization of the cDNA encoding a novel human pre-B-cell colony-enhancing factor. (PMID: 8289818) Samal B … McNiece I (Molecular and cellular biology 1994) 2 3 4 23 56
  2. Genetic variant in visfatin gene promoter is associated with decreased risk of coronary artery disease in a Chinese population. (PMID: 19804767) Yan JJ … Huang J (Clinica chimica acta; international journal of clinical chemistry 2010) 3 23 43 56
  3. The visfatin (PBEF1) G-948T gene polymorphism is associated with increased high-density lipoprotein cholesterol in obese subjects. (PMID: 18940394) Johansson LM … Ridderstråle M (Metabolism: clinical and experimental 2008) 3 23 43 56
  4. Molecular basis for the inhibition of human NMPRTase, a novel target for anticancer agents. (PMID: 16783377) Khan JA … Tong L (Nature structural & molecular biology 2006) 3 4 23 56
  5. Visfatin as a novel mediator released by inflamed human endothelial cells. (PMID: 24130902) Romacho T … Peiró C (PloS one 2013) 3 4 56

Products for NAMPT Gene

Sources for NAMPT Gene