This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelatinase A, type IV collagenase, that contains three fibronectin type II repeats in its catalytic site that allow binding of dena... See more...

Aliases for MMP2 Gene

Aliases for MMP2 Gene

  • Matrix Metallopeptidase 2 2 3 5
  • TBE-1 2 3 4
  • 72 KDa Type IV Collagenase 3 4
  • Matrix Metalloproteinase-2 3 4
  • EC 3.4.24.24 4 51
  • CLG4A 3 4
  • MMP-2 3 4
  • Matrix Metalloproteinase 2 (Gelatinase A, 72kDa Gelatinase, 72kDa Type IV Collagenase) 2
  • Matrix Metallopeptidase 2 (Gelatinase A, 72kDa Gelatinase, 72kDa Type IV Collagenase) 3
  • Matrix Metalloproteinase-II 3
  • Collagenase Type IV-A 3
  • Neutrophil Gelatinase 3
  • 72 KDa Gelatinase 4
  • Gelatinase A 4
  • EC 3.4.24 51
  • MMP-II 3
  • CLG4 3
  • MONA 3
  • MMP2 5

External Ids for MMP2 Gene

Previous HGNC Symbols for MMP2 Gene

  • CLG4
  • CLG4A

Previous GeneCards Identifiers for MMP2 Gene

  • GC16P045928
  • GC16P055478
  • GC16P055161
  • GC16P055291
  • GC16P054070
  • GC16P041400
  • GC16P055424

Summaries for MMP2 Gene

Entrez Gene Summary for MMP2 Gene

  • This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelatinase A, type IV collagenase, that contains three fibronectin type II repeats in its catalytic site that allow binding of denatured type IV and V collagen and elastin. Unlike most MMP family members, activation of this protein can occur on the cell membrane. This enzyme can be activated extracellularly by proteases, or, intracellulary by its S-glutathiolation with no requirement for proteolytical removal of the pro-domain. This protein is thought to be involved in multiple pathways including roles in the nervous system, endometrial menstrual breakdown, regulation of vascularization, and metastasis. Mutations in this gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]

CIViC Summary for MMP2 Gene

GeneCards Summary for MMP2 Gene

MMP2 (Matrix Metallopeptidase 2) is a Protein Coding gene. Diseases associated with MMP2 include Multicentric Osteolysis, Nodulosis, And Arthropathy and Multicentric Osteolysis-Nodulosis-Arthropathy Spectrum. Among its related pathways are Regulation of Wnt-mediated beta catenin signaling and target gene transcription and Degradation of the extracellular matrix. Gene Ontology (GO) annotations related to this gene include serine-type endopeptidase activity and metallopeptidase activity. An important paralog of this gene is MMP9.

UniProtKB/Swiss-Prot Summary for MMP2 Gene

  • Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14.
  • PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrinv/beta3 on the surface of blood vessels.
  • [Isoform 2]: Mediates the proteolysis of CHUK/IKKA and initiates a primary innate immune response by inducing mitochondrial-nuclear stress signaling with activation of the pro-inflammatory NF-kappaB, NFAT and IRF transcriptional pathways.

Tocris Summary for MMP2 Gene

  • Matrix metalloproteases (matrix metalloproteinase, MMPs), also called matrixins, are zinc-dependent endopeptidases and the major proteases in ECM degradation. MMPs are capable of degrading several extracellular molecules and a number of bioactive molecules.

Gene Wiki entry for MMP2 Gene

No data available for PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for MMP2 Gene

Genomics for MMP2 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for MMP2 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH16J055475 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 600.2 +89.8 89818 7.8 ATF7 ZNF692 ZIC2 PATZ1 EZH2 CEBPA NRF1 ZBTB20 JUND EGR1 NONHSAG019511.2 MMP2 ENSG00000279030 LPCAT2
GH16J055390 Enhancer 1.2 VISTA UCNEbase Ensembl ENCODE 600.7 +1.8 1750 4.1 STAT1 HLF MMP2 lnc-MMP2-1 piR-43105-236 LPCAT2
GH16J055387 Enhancer 0.7 Ensembl ENCODE 600.7 -1.9 -1900 2.8 FOXA1 ZNF217 DPF2 JUND ZNF146 FOS MTA2 SMARCE1 MMP2 lnc-MMP2-1 lnc-CES1-2 IRX6
GH16J055508 Promoter/Enhancer 2.2 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 14.5 +120.0 120001 3.4 ZNF692 ZIC2 RBFOX2 PATZ1 ETV6 ZNF341 NRF1 KLF9 MGA ZBTB20 LPCAT2 NONHSAG019512.2 MMP2 ENSG00000261997 CAPNS2
GH16J055444 Promoter 1.1 EPDnew Ensembl 11.1 +54.6 54605 1 IKZF2 EED DPF2 RELB GATAD2B ARNT NBN IKZF1 BMI1 TBX21 MMP2-AS1 MMP2 LPCAT2 IRX6 ENSG00000274508
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around MMP2 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for MMP2

Top Transcription factor binding sites by QIAGEN in the MMP2 gene promoter:
  • Sp1
  • SRF
  • SRF (504 AA)

Genomic Locations for MMP2 Gene

Genomic Locations for MMP2 Gene
chr16:55,389,700-55,506,691
(GRCh38/hg38)
Size:
116,992 bases
Orientation:
Plus strand
chr16:55,423,612-55,540,603
(GRCh37/hg19)
Size:
116,992 bases
Orientation:
Plus strand

Genomic View for MMP2 Gene

Genes around MMP2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MMP2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MMP2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MMP2 Gene

Proteins for MMP2 Gene

  • Protein details for MMP2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P08253-MMP2_HUMAN
    Recommended name:
    72 kDa type IV collagenase
    Protein Accession:
    P08253
    Secondary Accessions:
    • B2R6U1
    • B4DWH3
    • E9PE45
    • Q9UCJ8

    Protein attributes for MMP2 Gene

    Size:
    660 amino acids
    Molecular mass:
    73882 Da
    Cofactor:
    Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Interacts (via the C-terminal hemopexin-like domains-containing region) with the integrin alpha-V/beta-3; the interaction promotes vascular invasion in angiogenic vessels and melamoma cells. Interacts (via the C-terminal PEX domain) with TIMP2 (via the C-terminal); the interaction inhibits the degradation activity. Interacts with GSK3B.
    Miscellaneous:
    • [Isoform 2]: Induced by oxidative stress.

    Three dimensional structures from OCA and Proteopedia for MMP2 Gene

    Alternative splice isoforms for MMP2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for MMP2 Gene

Selected DME Specific Peptides for MMP2 Gene

P08253:
  • TLGEGQVVRVKYGNADGEYCKFPF
  • VWSDVTPL
  • PKTDKELAVQYLN
  • LFLVAAHE
  • LAHAFAPG
  • LPEKIDAVYE
  • YNFFPRK
  • LDAVVDLQG
  • DGKYGFCPHE
  • TGDLDQNTIETM
  • MQKFFGL
  • GQPCKFPFRFQGTSY
  • AAPSPIIKFPGD
  • DGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPG
  • DGYPFDG
  • VAAHEFGH
  • GEADIMI
  • YYLKLENQSLKSVK
  • PFTFLGNK
  • DGFLWCSTT
  • YDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHS
  • GLLAHAF
  • CNLFVLKDTLKKMQKFFGLP
  • PTLGPVTPE
  • NKKTYIF
  • KWGFCPD

Post-translational modifications for MMP2 Gene

  • Phosphorylation on multiple sites modulates enzymatic activity. Phosphorylated by PKC in vitro.
  • The propeptide is processed by MMP14 (MT-MMP1) and MMP16 (MT-MMP3). Autocatalytic cleavage in the C-terminal produces the anti-angiogenic peptide, PEX. This processing appears to be facilitated by binding integrinv/beta3.
  • Glycosylation at Asn573 and Asn642
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Abcam antibodies for MMP2

Domains & Families for MMP2 Gene

Gene Families for MMP2 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Candidate cardiovascular disease genes
  • Disease related genes
  • Enzymes
  • FDA approved drug targets
  • Plasma proteins
  • Predicted intracellular proteins
  • Predicted secreted proteins

Suggested Antigen Peptide Sequences for MMP2 Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ59773, highly similar to 72 kDa type IV collagenase (EC 3.4.24.24) (B4DWH3_HUMAN)
  • TBE-1 (MMP2_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P08253

UniProtKB/Swiss-Prot:

MMP2_HUMAN :
  • The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Belongs to the peptidase M10A family.
Domain:
  • The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
Family:
  • Belongs to the peptidase M10A family.
genes like me logo Genes that share domains with MMP2: view

Function for MMP2 Gene

Molecular function for MMP2 Gene

UniProtKB/Swiss-Prot Function:
Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14.
UniProtKB/Swiss-Prot Function:
PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrinv/beta3 on the surface of blood vessels.
UniProtKB/Swiss-Prot Function:
[Isoform 2]: Mediates the proteolysis of CHUK/IKKA and initiates a primary innate immune response by inducing mitochondrial-nuclear stress signaling with activation of the pro-inflammatory NF-kappaB, NFAT and IRF transcriptional pathways.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=Cleavage of gelatin type I and collagen types IV, V, VII, X. Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln.; EC=3.4.24.24; Evidence={ECO:0000305|PubMed:11179305, ECO:0000305|PubMed:11431697, ECO:0000305|PubMed:12147339, ECO:0000305|PubMed:2834383};.
UniProtKB/Swiss-Prot Induction:
Aspirin appears to inhibit expression.
UniProtKB/Swiss-Prot EnzymeRegulation:
Inhibited by histatin-3 1/24 (histatin-5).
GENATLAS Biochemistry:
matrix metalloproteinase 2,regulator in matrix remodeling,mainly expressed in placenta,lung,pancreas,ovary,spleen and intestine,involved in pathophysiology of malignant gliomas by glial invasion and angiogenesis,overexpressed in inflammatory bowel diseases

Enzyme Numbers (IUBMB) for MMP2 Gene

LifeMap Function Summary for MMP2 Gene

During embryonic development, MMP2 as signaling molecule is secreted from the following cells
It affects the following cells:

Phenotypes From GWAS Catalog for MMP2 Gene

Gene Ontology (GO) - Molecular Function for MMP2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004175 endopeptidase activity IDA 23845380
GO:0004222 metalloendopeptidase activity IEA,TAS --
GO:0004252 serine-type endopeptidase activity TAS --
GO:0005515 protein binding IPI 12032297
GO:0008233 peptidase activity IEA --
genes like me logo Genes that share ontologies with MMP2: view
genes like me logo Genes that share phenotypes with MMP2: view

Human Phenotype Ontology for MMP2 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for MMP2 Gene

MGI Knock Outs for MMP2:

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MMP2

No data available for Transcription Factor Targets and HOMER Transcription for MMP2 Gene

Localization for MMP2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MMP2 Gene

[Isoform 1]: Secreted, extracellular space, extracellular matrix. Membrane. Nucleus. Note=Colocalizes with integrin alphaV/beta3 at the membrane surface in angiogenic blood vessels and melanomas. Found in mitochondria, along microfibrils, and in nuclei of cardiomyocytes.
[Isoform 2]: Cytoplasm. Mitochondrion.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MMP2 gene
Compartment Confidence
extracellular 5
mitochondrion 5
nucleus 5
plasma membrane 4
cytoskeleton 3
endoplasmic reticulum 3
cytosol 3
peroxisome 2
endosome 2
lysosome 2
golgi apparatus 2

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for MMP2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region TAS --
GO:0005615 extracellular space TAS,IDA 18492766
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IEA --
GO:0005739 mitochondrion IEA --
genes like me logo Genes that share ontologies with MMP2: view

Pathways & Interactions for MMP2 Gene

genes like me logo Genes that share pathways with MMP2: view

Pathways by source for MMP2 Gene

4 GeneGo (Thomson Reuters) pathways for MMP2 Gene
  • Cell adhesion_ECM remodeling
  • Development EGFR signaling pathway
  • Transcription Androgen Receptor nuclear signaling
  • Transcription_P53 signaling pathway
6 Qiagen pathways for MMP2 Gene
  • Colorectal Cancer Metastasis
  • Glioma Invasiveness
  • Inhibition of Matrix Metalloproteinases
  • Pancreatic Adenocarcinoma
  • Transendothelial Migration of Leukocytes
2 Cell Signaling Technology pathways for MMP2 Gene
1 GeneTex pathway for MMP2 Gene

SIGNOR curated interactions for MMP2 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for MMP2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001525 angiogenesis IEA --
GO:0001666 response to hypoxia IBA 21873635
GO:0001955 blood vessel maturation IEA --
GO:0001957 intramembranous ossification IEA --
GO:0006508 proteolysis IEA,IDA 15863497
genes like me logo Genes that share ontologies with MMP2: view

Drugs & Compounds for MMP2 Gene

(110) Drugs for MMP2 Gene - From: DrugBank, ApexBio, DGIdb, IUPHAR, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Captopril Approved Pharma Inhibitor, Inhibition, Target, inhibitor ACE inhibitor, ACE inhibitor; also inhibits LTA4 hydrolase 50
tiludronate Approved, Investigational, Vet_approved Pharma 2
SC-74020 Experimental Pharma Target 0
CTS-1027 Experimental, Investigational Pharma MMPs inhibitor 0
Marimastat Investigational Pharma Target, inhibitor MMPs inhibitor,board spectrum 4

(50) Additional Compounds for MMP2 Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs

(3) Tocris Compounds for MMP2 Gene

Compound Action Cas Number
ARP 100 Selective inhibitor of MMP-2 704888-90-4
ARP 101 Inhibitor of MMP-2 849773-63-3
PD 166793 Broad spectrum MMP inhibitor 199850-67-4

(12) ApexBio Compounds for MMP2 Gene

Compound Action Cas Number
7-Methoxycoumarin-4-acetyl-P-L-G-L-β-(2,4-dinitrophenylamino)A-R amide Substrate of matrix metalloproteinases assay 140430-53-1
ARP 100 Selective MMP-2 inhibitor 704888-90-4
ARP 101 MMP inhibitor,potent and selective 849773-63-3
Batimastat (BB-94) MMP inhibitor 130370-60-4
CP 471474 Broad spectrum MMP inhibitor 210755-45-6
CTS-1027 MMPs inhibitor 193022-04-7
GM 6001 Broad spectrum MMP inhibitor 142880-36-2
Marimastat MMPs inhibitor,board spectrum 154039-60-8
ONO 4817 MMP inhibitor 223472-31-9
PD 166793 MMP inhibitor 199850-67-4
Phosphoramidon Disodium Salt 164204-38-0
SB-3CT gelatinases inhibitor, potent and selective 292605-14-2
genes like me logo Genes that share compounds with MMP2: view

Transcripts for MMP2 Gene

mRNA/cDNA for MMP2 Gene

5 REFSEQ mRNAs :
21 NCBI additional mRNA sequence :
8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MMP2

Alternative Splicing Database (ASD) splice patterns (SP) for MMP2 Gene

No ASD Table

Relevant External Links for MMP2 Gene

GeneLoc Exon Structure for
MMP2

Expression for MMP2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for MMP2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for MMP2 Gene

This gene is overexpressed in Amniocyte (49.4) and Serum (12.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for MMP2 Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for MMP2

SOURCE GeneReport for Unigene cluster for MMP2 Gene:

Hs.513617

mRNA Expression by UniProt/SwissProt for MMP2 Gene:

P08253-MMP2_HUMAN
Tissue specificity: Produced by normal skin fibroblasts. PEX is expressed in a number of tumors including gliomas, breast and prostate.

Evidence on tissue expression from TISSUES for MMP2 Gene

  • Nervous system(4.9)
  • Lung(4.7)
  • Bone(4.2)
  • Muscle(4.1)
  • Skin(4.1)
  • Heart(4)
  • Intestine(3.8)
  • Kidney(3.6)
  • Blood(3.5)
  • Gall bladder(3.4)
  • Pancreas(3.4)
  • Lymph node(3.3)
  • Liver(3.3)
  • Stomach(3.3)
  • Eye(3.2)
  • Spleen(3.2)
  • Adrenal gland(2.8)
  • Thyroid gland(2.8)
  • Bone marrow(2.7)
  • Urine(2.3)

Phenotype-based relationships between genes and organs from Gene ORGANizer for MMP2 Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • digestive
  • immune
  • integumentary
  • nervous
  • respiratory
  • skeletal muscle
  • skeleton
Regions:
Head and neck:
  • chin
  • ear
  • eye
  • eyelid
  • face
  • forehead
  • head
  • jaw
  • lip
  • mandible
  • maxilla
  • mouth
  • neck
  • nose
  • skull
  • tooth
Thorax:
  • chest wall
  • clavicle
  • lung
  • rib
  • rib cage
  • scapula
  • sternum
Pelvis:
  • pelvis
Limb:
  • ankle
  • arm
  • digit
  • elbow
  • femur
  • fibula
  • finger
  • foot
  • forearm
  • hand
  • hip
  • humerus
  • knee
  • lower limb
  • radius
  • shin
  • shoulder
  • thigh
  • tibia
  • toe
  • ulna
  • upper limb
  • wrist
General:
  • blood
  • hair
  • peripheral nerve
  • peripheral nervous system
  • skin
  • spinal column
  • vertebrae
  • white blood cell
genes like me logo Genes that share expression patterns with MMP2: view

No data available for mRNA differential expression in normal tissues and Protein tissue co-expression partners for MMP2 Gene

Orthologs for MMP2 Gene

This gene was present in the common ancestor of animals.

Orthologs for MMP2 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia MMP2 30 31
  • 99.24 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia MMP2 30 31
  • 91.48 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia MMP2 30 31
  • 90.69 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Mmp2 30 17 31
  • 89.44 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Mmp2 30
  • 88.43 (n)
Oppossum
(Monodelphis domestica)
Mammalia MMP2 31
  • 88 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia MMP2 31
  • 86 (a)
OneToOne
Chicken
(Gallus gallus)
Aves MMP2 30 31
  • 75.53 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia MMP2 31
  • 82 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia mmp2 30
  • 73.54 (n)
African clawed frog
(Xenopus laevis)
Amphibia Mmp2 30
Zebrafish
(Danio rerio)
Actinopterygii mmp2 30 31
  • 72.19 (n)
OneToOne
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.12093 30
Worm
(Caenorhabditis elegans)
Secernentea H19M22.3 31
  • 22 (a)
ManyToMany
zmp-1 31
  • 20 (a)
ManyToMany
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.1986 31
  • 49 (a)
OneToOne
Species where no ortholog for MMP2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Fruit Fly (Drosophila melanogaster)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for MMP2 Gene

ENSEMBL:
Gene Tree for MMP2 (if available)
TreeFam:
Gene Tree for MMP2 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for MMP2: view image

Paralogs for MMP2 Gene

(13) SIMAP similar genes for MMP2 Gene using alignment to 5 proteins:

  • MMP2_HUMAN
  • H3BR66_HUMAN
  • H3BS34_HUMAN
  • H3BV48_HUMAN
  • J3KRB7_HUMAN
genes like me logo Genes that share paralogs with MMP2: view

Variants for MMP2 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for MMP2 Gene

SNP ID Clinical significance and condition Chr 16 pos Variation AA Info Type
690375 Uncertain Significance: Multicentric osteolysis, nodulosis and arthropathy 55,483,132(+) A/G MISSENSE_VARIANT
712198 Likely Benign: not provided 55,505,424(+) C/T SYNONYMOUS_VARIANT
714021 Conflicting Interpretations: Multicentric osteolysis, nodulosis and arthropathy; not provided 55,502,869(+) C/T SYNONYMOUS_VARIANT
717634 Likely Benign: not provided 55,489,730(+) C/T SYNONYMOUS_VARIANT
720508 Benign: Multicentric osteolysis, nodulosis and arthropathy; not provided 55,491,847(+) G/A MISSENSE_VARIANT

Additional dbSNP identifiers (rs#s) for MMP2 Gene

Structural Variations from Database of Genomic Variants (DGV) for MMP2 Gene

Variant ID Type Subtype PubMed ID
esv9365 CNV gain 19470904

Variation tolerance for MMP2 Gene

Residual Variation Intolerance Score: 6.87% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.97; 49.57% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for MMP2 Gene

Human Gene Mutation Database (HGMD)
MMP2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
MMP2

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MMP2 Gene

Disorders for MMP2 Gene

MalaCards: The human disease database

(155) MalaCards diseases for MMP2 Gene - From: UniProtKB/Swiss-Prot, OMIM, ClinVar, GTR, Orphanet, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
multicentric osteolysis, nodulosis, and arthropathy
  • mona
multicentric osteolysis-nodulosis-arthropathy spectrum
  • nodulosis-arthropathy-osteolysis syndrome
arthropathy
  • ankylosis of ankle and foot joint
winchester syndrome
  • wnchrs
nasal cavity squamous cell carcinoma
  • squamous cell carcinoma of nasal cavity
- elite association - COSMIC cancer census association via MalaCards
Search MMP2 in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

MMP2_HUMAN
  • Multicentric osteolysis, nodulosis, and arthropathy (MONA) [MIM:259600]: An autosomal recessive syndrome characterized by severe multicentric osteolysis with predominant involvement of the hands and feet. Additional features include coarse face, corneal opacities, patches of thickened, hyperpigmented skin, hypertrichosis and gum hypertrophy. {ECO:0000269 PubMed:11431697, ECO:0000269 PubMed:15691365, ECO:0000269 PubMed:16542393}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Additional Disease Information for MMP2

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
genes like me logo Genes that share disorders with MMP2: view

No data available for Genatlas for MMP2 Gene

Publications for MMP2 Gene

  1. Single nucleotide polymorphisms in matrix metalloproteinase genes and lung cancer chemotherapy response and prognosis. (PMID: 19643940) Scherf DB … Risch A (The European respiratory journal 2010) 3 23 41
  2. Association of metalloproteinase gene polymorphisms with systemic sclerosis in the European Caucasian population. (PMID: 20110530) Wipff J … Allanore Y (The Journal of rheumatology 2010) 3 23 41
  3. Matrix metalloproteinase-7 (MMP-7) polymorphism is a risk factor for endometrial cancer susceptibility. (PMID: 20113256) Yi YC … Yang SF (Clinical chemistry and laboratory medicine 2010) 3 23 41
  4. Association of (-1,607) 1G/2G polymorphism of matrix metalloproteinase-1 gene with knee osteoarthritis in the Turkish population (knee osteoarthritis and MMPs gene polymorphisms). (PMID: 18802702) Barlas IO … Türkmen E (Rheumatology international 2009) 3 23 41
  5. Putative functional polymorphisms of MMP9 predict survival of NSCLC in a Chinese population. (PMID: 19132754) Jin G … Shen H (International journal of cancer 2009) 3 23 41

Products for MMP2 Gene

  • Addgene plasmids for MMP2

Sources for MMP2 Gene