Free for academic non-profit institutions. Other users need a Commercial license
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular prot... See more...
Aliases for MMP14 Gene
Aliases for MMP14 Gene
External Ids for MMP14 Gene
- HGNC: 7160
- NCBI Entrez Gene: 4323
- Ensembl: ENSG00000157227
- OMIM®: 600754
- UniProtKB/Swiss-Prot: P50281
Previous GeneCards Identifiers for MMP14 Gene
- GC14P020678
- GC14P017093
- GC14P021295
- GC14P022375
- GC14P023305
- GC14P003422
- GC14P022837
- GC14P024483
- GC14P024599
- GC14P024724
- GC14P025005
- GC14P022839
- GC14P023827
- GC14P023920
- GC14P024028
- GC14P024145
- GC14P024255
- GC14P024368
- GC14P025277
- GC14P025566
Summaries for MMP14 Gene
-
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion. [provided by RefSeq, Jul 2008]
GeneCards Summary for MMP14 Gene
MMP14 (Matrix Metallopeptidase 14) is a Protein Coding gene. Diseases associated with MMP14 include Winchester Syndrome and Multicentric Osteolysis-Nodulosis-Arthropathy Spectrum. Among its related pathways are Cell adhesion_ECM remodeling and AGE/RAGE pathway. Gene Ontology (GO) annotations related to this gene include DNA-binding transcription factor activity and metalloendopeptidase activity. An important paralog of this gene is MMP15.
UniProtKB/Swiss-Prot Summary for MMP14 Gene
-
Endopeptidase that degrades various components of the extracellular matrix such as collagen. Activates progelatinase A. Essential for pericellular collagenolysis and modeling of skeletal and extraskeletal connective tissues during development (By similarity). May be involved in actin cytoskeleton reorganization by cleaving PTK7 (PubMed:20837484). Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2 (PubMed:12714657). Cleaves ADGRB1 to release vasculostatin-40 which inhibits angiogenesis (PubMed:22330140).
-
Matrix metalloproteases (matrix metalloproteinase, MMPs), also called matrixins, are zinc-dependent endopeptidases and the major proteases in ECM degradation. MMPs are capable of degrading several extracellular molecules and a number of bioactive molecules.
Additional gene information for MMP14 Gene
No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for MMP14 Gene
Genomics for MMP14 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for MMP14 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around MMP14 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for MMP14
- Top Transcription factor binding sites by QIAGEN in the MMP14 gene promoter:
-
- AP-1
- AP-2alpha
- AP-2alpha isoform 2
- AP-2alpha isoform 3
- AP-2alpha isoform 4
- AP-2alphaA
- AP-4
- AREB6
- ATF-2
- c-Jun
Genomic Locations for MMP14 Gene
Latest Assembly
- chr14:22,836,560-22,849,041
- (GRCh38/hg38)
- Size:
- 12,482 bases
- Orientation:
- Plus strand
Previous Assembly
- chr14:23,305,794-23,316,967
- (GRCh37/hg19 by Entrez Gene)
- Size:
- 11,174 bases
- Orientation:
- Plus strand
Genomic View for MMP14 Gene
Genes around MMP14 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 14q11.2 by HGNC
- 14q11.2 by Entrez Gene
- 14q11.2 by Ensembl
MMP14 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for MMP14 Gene
Proteins for MMP14 Gene
-
Protein details for MMP14 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P50281-MMP14_HUMAN
- Recommended name:
- Matrix metalloproteinase-14
- Protein Accession:
- P50281
- A8K5L0
- Q6GSF3
- Q92678
Protein attributes for MMP14 Gene
- Size:
- 582 amino acids
- Molecular mass:
- 65894 Da
- Cofactor:
- Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
- Cofactor:
- Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
- Quaternary structure:
-
- Interacts (via C-terminal cytoplasmic tail) with BST2. Interacts with DLL1; inhibits DLL1-induced Notch signaling (PubMed:21572390).
Protein Expression for MMP14 Gene
Selected DME Specific Peptides for MMP14 Gene
- P50281:
-
- GGFLAHAYFPGP
- NYTPKVGE
- PRCGVPD
- AIMAPFYQ
- RGIQQLYG
- FVFFKGD
- LRDWMGC
- GHALGLEHS
- EAIRKAFRVWESATPLRFREVPYAYIREGHEKQAD
- AMRRPRCGVPDKFG
- LKVEPGYP
- LPTDKIDAALFWMPNGK
- VLPVLLLL
- RGEMFVFK
- LLLPLLTLGTALASLG
- DDRRGIQ
Post-translational modifications for MMP14 Gene
- The precursor is cleaved by a furin endopeptidase.
- Tyrosine phosphorylated by PKDCC/VLK.
-
Glycosylation at Thr77, Thr291, Thr299, Thr300, Ser301, and Ser304
- NX_P50281 (NX_P50281-1)
- Modification sites at PhosphoSitePlus
Other Protein References for MMP14 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibodies for research
- LifeSpan BioSciences MMP14 Antibody (LS-B3338) and MMP14 Antibody (LS-B9429)
- NSJ Bioreagents MMP14 Antibody (Mouse Monoclonal)
-
Custom Antibody ServicesOriGene Antibodies for MMP14
- Novus Biologicals Antibodies for MMP14
-
Abcam antibodies for MMP14
- Invitrogen Antibodies for MMP14 (AFLGC-MMP14)
- antibodies-online: Show 78 available MMP14 Antibodies ranked by validation data
- Compare Top MMP14 Antibodies
-
Recommended
- 214 WB Antibodies (anti-human)
- 8 FACS Antibodies (anti-human)
- 8 IHC (p) Antibodies (anti-human)
- 6 IHC Antibodies (anti-human)
- 4 IP Antibodies (anti-human)
- 60 WB Antibodies (anti-mouse)
- 4 IP Antibodies (anti-mouse)
- 3 IHC Antibodies (anti-mouse)
- 57 WB Antibodies (anti-rat)
- 4 IP Antibodies (anti-rat)
- 3 IHC Antibodies (anti-rat)
-
Boster Bio Antibodies for MMP14
-
Custom Antibody ServicesProSci Antibodies for MMP14
-
Santa Cruz Biotechnology (SCBT) Antibodies for MMP14
Protein products for research
- Search Origene for MassSpec and Protein Over-expression Lysates for MMP14
- Origene Custom Protein Services for MMP14
- ProSpec Recombinant Proteins for MMP14
-
Abcam proteins for MMP14
Assay products for research
-
Custom Assay ServicesOriGene ELISA Kits for MMP14
- Novus Biologicals ELISA Kits for MMP14
- antibodies-online: Show 38 available MMP14 Elisa Kits ranked by validation data
- Compare Top MMP14 Elisa Kits
-
Quality Products:
- ABIN415141
- ABIN457033
- ABIN1571271
- ABIN1884631
- ABIN5525119
- ABIN5510602
- ABIN1381326
- ABIN5656730
- ABIN2536442
- ABIN6254741
- ABIN425275
- ABIN818167
- ABIN1571272
- ABIN1884632
- ABIN5656731
- ABIN2536443
- ABIN4971052
- ABIN6254742
- ABIN6231328
- ABIN844135
- ABIN1884633
- ABIN6254743
- ABIN6231330
- ABIN6231331
- ABIN2684990
- ABIN1141723
-
Boster Bio ELISA Kits for MMP14
Domains & Families for MMP14 Gene
Gene Families for MMP14 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Cancer-related genes
- Disease related genes
- Enzymes
- FDA approved drug targets
- Plasma proteins
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for MMP14 Gene
- InterPro:
- Blocks:
-
- Hemopexin repeat
- Matrixin
- Putative peptidoglycan binding domain 1
Suggested Antigen Peptide Sequences for MMP14 Gene
- GenScript: Design optimal peptide antigens:
-
- Membrane-type-1 matrix metalloproteinase (MMP14_HUMAN)
Graphical View of Domain Structure for InterPro Entry
P50281UniProtKB/Swiss-Prot:
MMP14_HUMAN :- The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
- Belongs to the peptidase M10A family.
- Domain:
-
- The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
- Family:
-
- Belongs to the peptidase M10A family.
Function for MMP14 Gene
Molecular function for MMP14 Gene
- UniProtKB/Swiss-Prot Function:
- Endopeptidase that degrades various components of the extracellular matrix such as collagen. Activates progelatinase A. Essential for pericellular collagenolysis and modeling of skeletal and extraskeletal connective tissues during development (By similarity). May be involved in actin cytoskeleton reorganization by cleaving PTK7 (PubMed:20837484). Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2 (PubMed:12714657). Cleaves ADGRB1 to release vasculostatin-40 which inhibits angiogenesis (PubMed:22330140).
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=Endopeptidase activity. Activates progelatinase A by cleavage of the propeptide at 37-Asn-|-Leu-38. Other bonds hydrolyzed include 35-Gly-|-Ile-36 in the propeptide of collagenase 3, and 341-Asn-|-Phe-342, 441-Asp-|-Leu-442 and 354-Gln-|-Thr-355 in the aggrecan interglobular domain.; EC=3.4.24.80;.
- UniProtKB/Swiss-Prot Induction:
- Up-regulated by NANOS1.
- GENATLAS Biochemistry:
- matrix metalloproteinase 14,regulator in matrix remodeling in the MMP cluster,membrane-type,involved in pathophysiology of malignant gliomas by glial invasion and angiogenesis,required for the activation of MMP2 in the stronal cancer cells
Enzyme Numbers (IUBMB) for MMP14 Gene
Phenotypes From GWAS Catalog for MMP14 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004175 | endopeptidase activity | IDA | 20666777 |
| GO:0004222 | metalloendopeptidase activity | TAS,ISS | -- |
| GO:0005178 | integrin binding | IEA | -- |
| GO:0005515 | protein binding | IPI | 14718544 |
| GO:0008233 | peptidase activity | IEA | -- |
Phenotypes for MMP14 Gene
- MGI mutant phenotypes for MMP14:
-
inferred from 9 alleles
- normal phenotype
- nervous system phenotype
- muscle phenotype
- homeostasis/metabolism phenotype
- growth/size/body region phenotype
- cellular phenotype
- cardiovascular system phenotype
- behavior/neurological phenotype
- immune system phenotype
- respiratory system phenotype
- mortality/aging
- renal/urinary system phenotype
- hematopoietic system phenotype
- digestive/alimentary phenotype
- endocrine/exocrine gland phenotype
- reproductive system phenotype
- vision/eye phenotype
- limbs/digits/tail phenotype
- hearing/vestibular/ear phenotype
- skeleton phenotype
- integument phenotype
- embryo phenotype
- craniofacial phenotype
- adipose tissue phenotype
- no phenotypic analysis
- GenomeRNAi human phenotypes for MMP14:
-
- Strongly decreased CFP-tsO45G cell surface transport
- Decreased NF-kappaB reporter expression
- shRNA abundance <= 50%
- Reduced mammosphere formation
- no effect
- Decreased viability after Maraba virus infection
- Decreased vaccinia virus (VACV) infection
- Increased shRNA abundance (Z-score > 2)
- Increased shRNA abundance
- Decreased shRNA abundance (Z-score < -2)
Animal Models for MMP14 Gene
Animal Models for research
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for MMP14 - Starting at $85 >
- * MMP14 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for MMP14
-
Santa Cruz Biotechnology (SCBT) CRISPR for MMP14
miRNA for MMP14 Gene
- miRTarBase miRNAs that target MMP14
-
- hsa-miR-335-5p (MIRT016970)
- hsa-miR-145-5p (MIRT021533)
- hsa-miR-181a-5p (MIRT053694)
- hsa-miR-133a-3p (MIRT437400)
- hsa-miR-24-3p (MIRT437500)
- mmu-miR-692 (MIRT593112)
- hsa-miR-22-3p (MIRT732074)
- hsa-miR-10a-5p (MIRT734252)
- hsa-miR-193a-3p (MIRT734596)
- hsa-miR-150-5p (MIRT734650)
- hsa-miR-143-3p (MIRT734787)
- hsa-miR-133b (MIRT735376)
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for MMP14
- Browse OriGene Inhibitory RNA Products For MMP14
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MMP14
Clone products for research
- Applied Biological Materials (abm): Clones for MMP14 - Starting at $45 >
- * MMP14 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for MMP14
- Addgene plasmids for MMP14
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for MMP14
Cell Lines for research
-
Horizon Cell Lines for MMP14
No data available for Transcription Factor Targets and HOMER Transcription for MMP14 Gene
Localization for MMP14 Gene
Subcellular locations from UniProtKB/Swiss-Prot for MMP14 Gene
- Membrane. Single-pass type I membrane protein. Melanosome. Cytoplasm. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Forms a complex with BST2 and localizes to the cytoplasm.
| Compartment | Confidence |
|---|---|
| plasma membrane | 5 |
| cytoskeleton | 5 |
| endosome | 5 |
| extracellular | 4 |
| nucleus | 4 |
| cytosol | 4 |
| golgi apparatus | 4 |
| mitochondrion | 2 |
| endoplasmic reticulum | 2 |
| lysosome | 2 |
| peroxisome | 1 |
- Cytosol (2)
- Intermediate filaments (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005615 | extracellular space | IMP | 24784232 |
| GO:0005634 | nucleus | IMP | 24784232 |
| GO:0005737 | colocalizes_with cytoplasm | IEA,IDA | 22065321 |
| GO:0005796 | Golgi lumen | TAS | -- |
| GO:0005829 | cytosol | IDA | -- |
Pathways & Interactions for MMP14 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Matrix Metalloproteinases |
Inhibition of Matrix Metalloproteinases
.69
|
|
| 2 | Degradation of the extracellular matrix | ||
| 3 | Adhesion |
-
|
|
| 4 | Development Endothelin-1/EDNRA signaling | ||
| 5 | Parathyroid hormone synthesis, secretion and action | ||
Pathways by source for MMP14 Gene
5 BioSystems pathways for MMP14 Gene
4 Reactome pathways for MMP14 Gene
3 KEGG pathways for MMP14 Gene
1 GeneGo (Thomson Reuters) pathway for MMP14 Gene
- Cell adhesion_ECM remodeling
2 Qiagen pathways for MMP14 Gene
- Colorectal Cancer Metastasis
- Inhibition of Matrix Metalloproteinases
1 Cell Signaling Technology pathway for MMP14 Gene
Interacting Proteins for MMP14 Gene
Selected Interacting proteins:
P50281-MMP14_HUMAN
ENSP00000308208
for MMP14 Gene via
UniProtKB
MINT
STRING
IID
GPS-Prot Interaction Network for MMP14
SIGNOR curated interactions for MMP14 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0001501 | skeletal system development | IBA | 21873635 |
| GO:0001503 | ossification | IEA | -- |
| GO:0001525 | angiogenesis | IEA | -- |
| GO:0001541 | ovarian follicle development | IEA | -- |
| GO:0001666 | response to hypoxia | IEA | -- |
Drugs & Compounds for MMP14 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Marimastat | Investigational | Pharma | Target, inhibitor | MMPs inhibitor,board spectrum | 4 | |
| Prinomastat | Investigational | Pharma | inhibitor, Vaccine | Vaccines | 3 | |
| Calcium | Nutra | 6959 | ||||
| NSC 405020 | Pharma | MT1-MMP inhibitor | 0 | |||
| ARP 100 | Pharma | Selective MMP-2 inhibitor, Selective inhibitor of MMP-2 | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs |
|---|
(3) Tocris Compounds for MMP14 Gene
(2) ApexBio Compounds for MMP14 Gene
| Compound | Action | Cas Number |
|---|---|---|
| Marimastat | MMPs inhibitor,board spectrum | 154039-60-8 |
| NSC 405020 | MT1-MMP inhibitor | 7497-07-6 |
Transcripts for MMP14 Gene
mRNA/cDNA for MMP14 Gene
- 1 REFSEQ mRNAs :
- 12 NCBI additional mRNA sequence :
- 8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000311852 3701 nts (view in UCSC)
- ENST00000547074 560 nts (view in UCSC)
- ENST00000547279 412 nts (view in UCSC)
- ENST00000547596 575 nts (view in UCSC)
- ENST00000548162 1754 nts (view in UCSC)
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for MMP14 - Starting at $85 >
- * MMP14 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for MMP14
-
Santa Cruz Biotechnology (SCBT) CRISPR for MMP14
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for MMP14
- Browse OriGene Inhibitory RNA Products For MMP14
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MMP14
Clone products for research
- Applied Biological Materials (abm): Clones for MMP14 - Starting at $45 >
- * MMP14 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for MMP14
- Addgene plasmids for MMP14
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for MMP14
Relevant External Links for MMP14 Gene
- GeneLoc Exon Structure for
- MMP14
Expression for MMP14 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Bone (Muscoskeletal System)
- Terminal Chondrocytes Caudal Facial Endochondral Bones
- Terminal Chondrocytes Mandibular Condyle
- Terminal Chondrocytes Rib
- Terminal Chondrocytes Stylopod Growth Plate
- Hypertrophic Chondrocytes Mandibular Condyle
-
Cartilage (Muscoskeletal System)
- Terminal Chondrocytes Caudal Facial Endochondral Bones
- Terminal Chondrocytes Mandibular Condyle
- Terminal Chondrocytes Rib
- Terminal Chondrocytes Stylopod Growth Plate
- Hypertrophic Chondrocytes Mandibular Condyle
-
Tooth (Integumentary System)
- Early Ameloblasts Dental Enamel
- Dental Papilla Cells Dental Papilla
- Primary Enamel Knot Cells Enamel Knot
- Odontoblasts Dentin
- Inner Enamel Epithelial Cells Dental Enamel
-
Epithelial Cells
- Early Ameloblasts Dental Enamel
- Inner Enamel Epithelial Cells Dental Enamel
- Outer Enamel Epithelial Cells Dental Enamel
-
Heart (Cardiovascular System)
- Atrioventricular Canal Cells Atrioventricular Canal
- Outflow Tract
- Smooth Muscle (Muscoskeletal System)
-
Uterus (Reproductive System)
-
Placenta (Extraembryonic Tissues)
-
Gall Bladder (Hepatobiliary System)
-
Ovary (Reproductive System)
This gene is overexpressed in Amniocyte (42.1), Bone (8.3), and Liver (6.2).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for MMP14 Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for MMP14
SOURCE GeneReport for Unigene cluster for MMP14 Gene:
Hs.2399mRNA Expression by UniProt/SwissProt for MMP14 Gene:
P50281-MMP14_HUMAN
Tissue specificity:
Expressed in stromal cells of colon, breast, and head and neck. Expressed in lung tumors.
Evidence on tissue expression from TISSUES for MMP14 Gene
- Lung(4.7)
- Skin(4.6)
- Nervous system(3.1)
- Heart(2.9)
- Intestine(2.9)
- Muscle(2.8)
- Lymph node(2.7)
- Kidney(2.7)
- Stomach(2.5)
- Gall bladder(2.4)
- Spleen(2.4)
- Liver(2.4)
- Pancreas(2.4)
- Blood(2.3)
- Eye(2.3)
- Thyroid gland(2.2)
- Bone(2.1)
Phenotype-based relationships between genes and organs from Gene ORGANizer for MMP14 Gene
Germ Layers:
- ectoderm
- endoderm
- mesoderm
Systems:
- digestive
- immune
- integumentary
- nervous
- respiratory
- skeletal muscle
- skeleton
Regions:
Head and neck:
- chin
- ear
- eye
- eyelid
- face
- forehead
- head
- jaw
- lip
- mandible
- maxilla
- mouth
- neck
- nose
- skull
- tooth
Thorax:
- chest wall
- clavicle
- lung
- rib
- rib cage
- scapula
- sternum
Pelvis:
- pelvis
Limb:
- ankle
- arm
- digit
- elbow
- femur
- fibula
- finger
- foot
- forearm
- hand
- hip
- humerus
- knee
- lower limb
- radius
- shin
- shoulder
- thigh
- tibia
- toe
- ulna
- upper limb
- wrist
General:
- blood
- hair
- peripheral nerve
- peripheral nervous system
- skin
- spinal column
- vertebrae
- white blood cell
Primer products for research
-
OriGene qPCR primer pairs for MMP14
-
OriGene qPCR primer pairs and template standards for MMP14
Gene Expression Assays for research
No data available for mRNA differential expression in normal tissues for MMP14 Gene
Orthologs for MMP14 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | MMP14 29 30 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | MMP-14 30 |
|
OneToOne | |
| MMP14 29 |
|
||||
| Cow (Bos Taurus) |
Mammalia | MMP14 29 30 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Mmp14 29 16 30 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Mmp14 29 |
|
||
| Oppossum (Monodelphis domestica) |
Mammalia | MMP14 30 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | MMP14 30 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | MMP14 30 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | mmp14 29 |
|
||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.23718 29 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | mmp14b 29 29 30 |
|
OneToMany | |
| mmp14a 30 |
|
OneToMany | |||
| Fruit Fly (Drosophila melanogaster) |
Insecta | Mmp1 29 31 |
|
||
| Mmp2 30 31 |
|
OneToMany | |||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP006904 29 |
|
||
| Worm (Caenorhabditis elegans) |
Secernentea | H36L18.1 29 |
|
||
| H19M22.3a 31 |
|
|
|||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | -- 30 |
|
ManyToMany |
- Species where no ortholog for MMP14 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chicken (Gallus gallus)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for MMP14 Gene
- ENSEMBL:
- Gene Tree for MMP14 (if available)
- TreeFam:
- Gene Tree for MMP14 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for MMP14: view image
- Alliance of Genome Resources:
- Additional Orthologs for MMP14
Paralogs for MMP14 Gene
Paralogs for MMP14 Gene
(18) SIMAP similar genes for MMP14 Gene using alignment to 4 proteins:
- MMP14_HUMAN
- F8VP90_HUMAN
- F8W1B7_HUMAN
- K4RH61_HUMAN
Variants for MMP14 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for MMP14 Gene
| SNP ID | Clinical significance and condition | Chr 14 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs138999323 | Benign: not provided | 22,844,475(+) |
C/T NM_004995.4(MMP14):c.1116C>T (p.Tyr372=) |
SYNONYMOUS | |
| rs139288377 | Likely Benign: not provided | 22,841,491(+) |
G/C NM_004995.4(MMP14):c.109G>C (p.Ala37Pro) |
MISSENSE | |
| rs147241325 | Likely Benign: not provided | 22,844,373(+) |
G/A NM_004995.4(MMP14):c.1014G>A (p.Glu338=) |
SYNONYMOUS | |
| rs148273315 | Likely Benign: not provided | 22,845,724(+) |
C/T NM_004995.4(MMP14):c.1434C>T (p.Tyr478=) |
SYNONYMOUS | |
| rs1595014702 | Uncertain Significance: Winchester syndrome | 22,842,571(+) |
T/C NM_004995.4(MMP14):c.542T>C (p.Phe181Ser) |
MISSENSE |
All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv3633763 | CNV | gain | 21293372 |
| nsv1070211 | CNV | deletion | 25765185 |
| nsv1143607 | CNV | deletion | 24896259 |
| nsv563998 | CNV | gain | 21841781 |
| nsv952816 | CNV | deletion | 24416366 |
Residual Variation Intolerance Score:
23.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
6.83;
79.24% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for MMP14 Gene
SNP Genotyping and Copy Number Assays for research
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MMP14 Gene
Disorders for MMP14 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| winchester syndrome |
|
|
| multicentric osteolysis-nodulosis-arthropathy spectrum |
|
|
| fibrosarcoma |
|
|
| cervical squamous cell carcinoma |
|
|
| larynx cancer |
|
|
Search MMP14 in MalaCards
View complete list of genes associated with diseases
UniProtKB/Swiss-Prot
MMP14_HUMAN- Winchester syndrome (WNCHRS) [MIM:277950]: A disease characterized by severe osteolysis in the hands and feet, generalized osteoporosis, bone thinning, and absence of subcutaneous nodules. Various additional features include coarse face, corneal opacities, gum hypertrophy, and EKG changes. {ECO:0000269 PubMed:22922033}. Note=The disease is caused by variants affecting the gene represented in this entry.
Additional Disease Information for MMP14
- Human Genome Epidemiology Navigator
- (HuGE)
- Atlas
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
- Open Targets Platform
No data available for Genatlas for MMP14 Gene
Publications for MMP14 Gene
- Mutation of membrane type-1 metalloproteinase, MT1-MMP, causes the multicentric osteolysis and arthritis disease Winchester syndrome. (PMID: 22922033) Evans BR … Martignetti JA (American journal of human genetics 2012) 3 4 72
- Association of metalloproteinase gene polymorphisms with systemic sclerosis in the European Caucasian population. (PMID: 20110530) Wipff J … Allanore Y (The Journal of rheumatology 2010) 3 22 40
- Matrix metalloproteinase gene polymorphisms and bronchopulmonary dysplasia: identification of MMP16 as a new player in lung development. (PMID: 18784838) Hadchouel A … Delacourt C (PloS one 2008) 3 22 40
- Crystal structure of the complex formed by the membrane type 1-matrix metalloproteinase with the tissue inhibitor of metalloproteinases-2, the soluble progelatinase A receptor. (PMID: 9724659) Fernandez-Catalan C … Maskos K (The EMBO journal 1998) 3 4 22
- Regulation of membrane-type matrix metalloproteinase-1 expression by growth factors and phorbol 12-myristate 13-acetate. (PMID: 8706726) Lohi J … Keski-Oja J (European journal of biochemistry 1996) 3 4 22
ExternalLinks
Products for MMP14 Gene
- View all 15 R&D Systems MMP14 (MMP-14/MT1-MMP) Products
- View all 2 R&D Systems MMP14 (MMP-14/MT1-MMP) Proteins and Enzymes
- View all 12 R&D Systems MMP14 (MMP-14/MT1-MMP) Primary Antibodies
- View all R&D Systems MMP14 (MMP-14/MT1-MMP) ELISAs
- Learn more about R&D Systems custom MMP14 antibody, protein, and immunoassay development services
- Custom Antibody ServicesOriGene Antibodies for MMP14
- Custom Assay ServicesOriGene ELISA Kits for MMP14
- Search Origene for MassSpec and Protein Over-expression Lysates for MMP14
- Origene Custom Protein Services for MMP14
- Origene shrna, sirna, and RNAi products in human, mouse, rat for MMP14
- Browse OriGene Inhibitory RNA Products For MMP14
- OriGene qPCR primer pairs for MMP14
- OriGene qPCR primer pairs and template standards for MMP14
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For MMP14
- Sino Biological Human cDNA Clone for MMP14
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for MMP14
- Novus Biologicals proteins and lysates for MMP14
- Novus Biologicals ELISA Kits for MMP14
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for MMP14
- Abcam proteins for MMP14
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ApexBio compounds for MMP14
- VectorBuilder Custom and pre-made DNA vectors for MMP14 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for MMP14 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for MMP14 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for MMP14 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for MMP14
- Addgene plasmids for MMP14
- antibodies-online: Show 78 available MMP14 Antibodies ranked by validation data
- Compare Top MMP14 Antibodies
- Recommended
- 214 WB Antibodies (anti-human)
- 8 FACS Antibodies (anti-human)
- 8 IHC (p) Antibodies (anti-human)
- 6 IHC Antibodies (anti-human)
- 4 IP Antibodies (anti-human)
- 60 WB Antibodies (anti-mouse)
- 4 IP Antibodies (anti-mouse)
- 3 IHC Antibodies (anti-mouse)
- 57 WB Antibodies (anti-rat)
- 4 IP Antibodies (anti-rat)
- 3 IHC Antibodies (anti-rat)
- antibodies-online: Show 38 available MMP14 Elisa Kits ranked by validation data
- Compare Top MMP14 Elisa Kits
- Quality Products:
- ABIN415141
- ABIN457033
- ABIN1571271
- ABIN1884631
- ABIN5525119
- ABIN5510602
- ABIN1381326
- ABIN5656730
- ABIN2536442
- ABIN6254741
- ABIN425275
- ABIN818167
- ABIN1571272
- ABIN1884632
- ABIN5656731
- ABIN2536443
- ABIN4971052
- ABIN6254742
- ABIN6231328
- ABIN844135
- ABIN1884633
- ABIN6254743
- ABIN6231330
- ABIN6231331
- ABIN2684990
- ABIN1141723
- antibodies-online: Show 26 available MMP14 Proteins ranked by validation data
- Compare Top MMP14 Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for MMP14
- Search Santa Cruz Biotechnology (SCBT) for MMP14 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for MMP14
- Custom Antibody ServicesProSci Antibodies for MMP14
- Search for MMP14 Proteins at ProSci
- Horizon Cell Lines for MMP14
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for MMP14
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for MMP14
- Search GeneCopoeia for miRNA 3'UTR Target clone products for MMP14
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MMP14
- Biorbyt antibodies for MMP14