Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.[supplied by OMIM, Apr 2004] See more...

Aliases for MGRN1 Gene

Aliases for MGRN1 Gene

  • Mahogunin Ring Finger 1 2 3 5
  • Mahogunin Ring Finger 1, E3 Ubiquitin Protein Ligase 2 3
  • RING-Type E3 Ubiquitin Transferase MGRN1 3 4
  • E3 Ubiquitin-Protein Ligase MGRN1 3 4
  • Mahogunin RING Finger Protein 1 3 4
  • RING Finger Protein 156 3 4
  • RNF156 3 4
  • Probable E3 Ubiquitin-Protein Ligase MGRN1 3
  • Mahogunin, Ring Finger 1 2
  • EC 2.3.2.27 4
  • KIAA0544 4
  • EC 6.3.2 54

External Ids for MGRN1 Gene

Previous GeneCards Identifiers for MGRN1 Gene

  • GC16P004708
  • GC16P004675
  • GC16P004614
  • GC16P004674

Summaries for MGRN1 Gene

Entrez Gene Summary for MGRN1 Gene

  • Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.[supplied by OMIM, Apr 2004]

GeneCards Summary for MGRN1 Gene

MGRN1 (Mahogunin Ring Finger 1) is a Protein Coding gene. Among its related pathways are Ubiquitin mediated proteolysis and Class I MHC mediated antigen processing and presentation. Gene Ontology (GO) annotations related to this gene include ligase activity and ubiquitin-protein transferase activity. An important paralog of this gene is RNF157.

UniProtKB/Swiss-Prot Summary for MGRN1 Gene

  • E3 ubiquitin-protein ligase. Mediates monoubiquitination at multiple sites of TSG101 in the presence of UBE2D1, but not of UBE2G1, nor UBE2H. Plays a role in the regulation of endosome-to-lysosome trafficking. Impairs MC1R- and MC4R-signaling by competing with GNAS-binding to MCRs and inhibiting agonist-induced cAMP production. Does not inhibit ADRB2-signaling. Does not promote MC1R ubiquitination. Acts also as a negative regulator of hedgehog signaling (By similarity).

Additional gene information for MGRN1 Gene

No data available for CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for MGRN1 Gene

Genomics for MGRN1 Gene

GeneHancer (GH) Regulatory Elements for MGRN1 Gene

Promoters and enhancers for MGRN1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH16J004611 Promoter/Enhancer 2.4 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 766.7 -0.9 -921 9.1 SIN3A ZNF24 SP1 ZBTB40 CTCF SREBF1 SIX5 ZBTB6 FOXA1 MLX MGRN1 UBALD1 lnc-MGRN1-1 CREBBP ZNF500 CDIP1 ANKS3 EEF2KMT HMOX2
GH16J004623 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 766.4 +9.0 9035 3.7 ZNF24 CTCF SREBF1 SIX5 POLR2A ATF1 CREB1 HCFC1 MIXL1 MYC MGRN1 ZNF500 CREBBP ENSG00000261442 CDIP1 HMOX2 NMRAL1 hsa-miR-5095-179
GH16J004692 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 29.5 +77.7 77730 4.3 ZNF785 SP1 ZBTB6 POLR2A FOS MIXL1 NFYC L3MBTL2 MAX MNT HSALNG0109272 NUDT16L1 CREBBP ZNF500 MGRN1 UBN1 EEF2KMT ANKS3 ALG1 HMOX2
GH16J004675 Promoter/Enhancer 1.3 Ensembl ENCODE dbSUPER 46.6 +61.7 61732 6.3 TCF7L2 NR2F6 MYC MAX ZNF121 MNT NFIB POLR2A SP1 DPF2 MGRN1 ZNF500 HSALNG0109269 hsa-miR-5095-180
GH16J004658 Enhancer 1.5 FANTOM5 Ensembl ENCODE dbSUPER 33.3 +46.2 46164 7.5 LCORL ZBTB6 MLX RBPJ NR2F1 NR2F6 CREB1 MIXL1 ZNF362 MYC MGRN1 NUDT16L1 PPL SEPTIN12 CORO7 GLYR1 NAGPA ENSG00000278700 MIR6769A
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around MGRN1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the MGRN1 gene promoter:
  • CREB
  • FOXO1
  • FOXO1a
  • FOXO4
  • GATA-1
  • GATA-2
  • GATA-3
  • Nkx2-2
  • RORalpha2
  • SRY

Genomic Locations for MGRN1 Gene

Genomic Locations for MGRN1 Gene
chr16:4,616,493-4,690,974
(GRCh38/hg38)
Size:
74,482 bases
Orientation:
Plus strand
chr16:4,666,494-4,740,975
(GRCh37/hg19)
Size:
74,482 bases
Orientation:
Plus strand

Genomic View for MGRN1 Gene

Genes around MGRN1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MGRN1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MGRN1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MGRN1 Gene

Proteins for MGRN1 Gene

  • Protein details for MGRN1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O60291-MGRN1_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase MGRN1
    Protein Accession:
    O60291
    Secondary Accessions:
    • A4URL3
    • A4URL4
    • Q86W76

    Protein attributes for MGRN1 Gene

    Size:
    552 amino acids
    Molecular mass:
    60753 Da
    Quaternary structure:
    • Interacts with MC1R and MC4R, but not with TBXA2R. Interacts with TSG101. Interacts with mislocalized cytosolically exposed PRNP; this interaction alters MGRN1 subcellular location and causes lysosomal enlargement (By similarity).
    SequenceCaution:
    • Sequence=BAA25470.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Alternative splice isoforms for MGRN1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for MGRN1 Gene

Selected DME Specific Peptides for MGRN1 Gene

O60291:
  • IPSAPLYEEI
  • CADTLRYQANNCPICRLPFRALLQIRAVRKK
  • VTGHAHVLLAAFE
  • RPVQFPYVTPA
  • SHFFMGGEKFDTPHPEGYLFGENMDLNFLG
  • QQFSLPSFKIDF
  • SETVHYKRG

Post-translational modifications for MGRN1 Gene

Domains & Families for MGRN1 Gene

Gene Families for MGRN1 Gene

Protein Domains for MGRN1 Gene

Blocks:
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for MGRN1 Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ60814, highly similar to Probable E3 ubiquitin-protein ligase MGRN1(EC 6.3.2.-) (B4DR12_HUMAN)
  • RING finger protein 156 (MGRN1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

O60291

UniProtKB/Swiss-Prot:

MGRN1_HUMAN :
  • The RING finger is required for ubiquitin ligase activity.
Domain:
  • The RING finger is required for ubiquitin ligase activity.
genes like me logo Genes that share domains with MGRN1: view

Function for MGRN1 Gene

Molecular function for MGRN1 Gene

UniProtKB/Swiss-Prot Function:
E3 ubiquitin-protein ligase. Mediates monoubiquitination at multiple sites of TSG101 in the presence of UBE2D1, but not of UBE2G1, nor UBE2H. Plays a role in the regulation of endosome-to-lysosome trafficking. Impairs MC1R- and MC4R-signaling by competing with GNAS-binding to MCRs and inhibiting agonist-induced cAMP production. Does not inhibit ADRB2-signaling. Does not promote MC1R ubiquitination. Acts also as a negative regulator of hedgehog signaling (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.; EC=2.3.2.27;.

Enzyme Numbers (IUBMB) for MGRN1 Gene

Phenotypes From GWAS Catalog for MGRN1 Gene

Gene Ontology (GO) - Molecular Function for MGRN1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004842 ubiquitin-protein transferase activity IDA 17229889
GO:0005515 protein binding IPI 17229889
GO:0016740 transferase activity IEA --
GO:0016874 ligase activity IEA --
GO:0046872 metal ion binding IEA --
genes like me logo Genes that share ontologies with MGRN1: view
genes like me logo Genes that share phenotypes with MGRN1: view

Animal Model Products

CRISPR Products

Clone Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for MGRN1 Gene

Localization for MGRN1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MGRN1 Gene

Early endosome. Note=The endosomal localization is dependent on the interaction with TSG101.
Isoform 1: Cytoplasm, cytosol. Nucleus. Note=Translocation from the cytosol to the nucleus is seen only in the presence of MC1R and MC4R, but not TBXA2R. Excluded from nucleoli.
Isoform 2: Cytoplasm, cytosol. Nucleus. Note=Translocation from the cytosol to the nucleus is seen only in the presence of MC1R and MC4R, but not TBXA2R. Excluded from nucleoli.
Isoform 3: Cytoplasm, cytosol. Cell membrane.
Isoform 4: Cytoplasm, cytosol. Cell membrane.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MGRN1 gene
Compartment Confidence
plasma membrane 5
nucleus 5
endosome 5
cytosol 5
mitochondrion 1
endoplasmic reticulum 1
lysosome 1

Gene Ontology (GO) - Cellular Components for MGRN1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IDA,IBA 17229889
GO:0005737 cytoplasm IBA,IDA 17229889
GO:0005768 endosome IEA --
GO:0005769 early endosome IBA,IDA 17229889
GO:0005829 cytosol IEA --
genes like me logo Genes that share ontologies with MGRN1: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for MGRN1 Gene

Pathways & Interactions for MGRN1 Gene

genes like me logo Genes that share pathways with MGRN1: view

UniProtKB/Swiss-Prot O60291-MGRN1_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for MGRN1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000209 protein polyubiquitination IEA --
GO:0006513 protein monoubiquitination IMP 17229889
GO:0008333 endosome to lysosome transport IMP,IBA 17229889
GO:0016567 protein ubiquitination IBA 21873635
GO:0043951 negative regulation of cAMP-mediated signaling IDA,IBA 19737927
genes like me logo Genes that share ontologies with MGRN1: view

No data available for SIGNOR curated interactions for MGRN1 Gene

Drugs & Compounds for MGRN1 Gene

(3) Drugs for MGRN1 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved, Investigational Nutra 0
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0

(1) Additional Compounds for MGRN1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • [(ho)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • PYROphosphATE
14000-31-8
genes like me logo Genes that share compounds with MGRN1: view

Transcripts for MGRN1 Gene

CRISPR Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for MGRN1 Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18a · 18b ^ 19 ^ 20 ^ 21a · 21b ^
SP1: - - - - - -
SP2: - - - -
SP3: - - - - -
SP4: - - -
SP5: -
SP6: -
SP7: -
SP8:
SP9:

ExUns: 22a · 22b
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:

Relevant External Links for MGRN1 Gene

GeneLoc Exon Structure for
MGRN1
ECgene alternative splicing isoforms for
MGRN1

Expression for MGRN1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for MGRN1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for MGRN1 Gene

This gene is overexpressed in Fetal Brain (32.2), Retina (7.0), and Frontal cortex (6.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for MGRN1 Gene



Protein tissue co-expression partners for MGRN1 Gene

NURSA nuclear receptor signaling pathways regulating expression of MGRN1 Gene:

MGRN1

SOURCE GeneReport for Unigene cluster for MGRN1 Gene:

Hs.526494

Evidence on tissue expression from TISSUES for MGRN1 Gene

  • Nervous system(4.7)
  • Blood(4.1)
genes like me logo Genes that share expression patterns with MGRN1: view

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for MGRN1 Gene

Orthologs for MGRN1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for MGRN1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MGRN1 33 32
  • 99.28 (n)
OneToOne
cow
(Bos Taurus)
Mammalia -- 33
  • 91 (a)
OneToMany
MGRN1 33 32
  • 87.21 (n)
OneToMany
dog
(Canis familiaris)
Mammalia MGRN1 33 32
  • 87.68 (n)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia -- 33
  • 87 (a)
OneToMany
-- 33
  • 71 (a)
OneToMany
mouse
(Mus musculus)
Mammalia Mgrn1 17 33 32
  • 86.07 (n)
rat
(Rattus norvegicus)
Mammalia Mgrn1 32
  • 85.49 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia MGRN1 33
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves MGRN1 33 32
  • 78.64 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia MGRN1 33
  • 78 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia mgrn1 32
  • 75.76 (n)
zebrafish
(Danio rerio)
Actinopterygii mgrn1a 33
  • 70 (a)
OneToMany
mgrn1b 33 32
  • 69.88 (n)
OneToMany
wufi38c03 32
fruit fly
(Drosophila melanogaster)
Insecta CG9941 33
  • 28 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea C11H1.3 33
  • 30 (a)
OneToMany
rice
(Oryza sativa)
Liliopsida Os01g0374900 32
  • 53.39 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 33
  • 40 (a)
OneToMany
Species where no ortholog for MGRN1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for MGRN1 Gene

ENSEMBL:
Gene Tree for MGRN1 (if available)
TreeFam:
Gene Tree for MGRN1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for MGRN1: view image

Paralogs for MGRN1 Gene

Paralogs for MGRN1 Gene

(1) SIMAP similar genes for MGRN1 Gene using alignment to 7 proteins:

  • MGRN1_HUMAN
  • B4DR12_HUMAN
  • E9PB19_HUMAN
  • K7EIM7_HUMAN
  • K7EJN3_HUMAN
  • K7EPJ5_HUMAN
  • K7ERA1_HUMAN
genes like me logo Genes that share paralogs with MGRN1: view

Variants for MGRN1 Gene

Sequence variations from dbSNP and Humsavar for MGRN1 Gene

SNP ID Clin Chr 16 pos Variation AA Info Type
rs1000005991 -- 4,686,957(+) GGGG/GGGGG 3_prime_UTR_variant, intron_variant
rs1000030996 -- 4,647,947(+) C/G/T intron_variant
rs1000125700 -- 4,660,245(+) G/A intron_variant
rs1000149491 -- 4,686,510(+) C/T 3_prime_UTR_variant, intron_variant
rs1000155459 -- 4,653,635(+) C/A/T intron_variant

Structural Variations from Database of Genomic Variants (DGV) for MGRN1 Gene

Variant ID Type Subtype PubMed ID
esv2659384 CNV deletion 23128226
esv2671090 CNV deletion 23128226
esv28573 CNV gain 19812545
esv3553043 CNV deletion 23714750
esv3637699 CNV loss 21293372
nsv1046986 CNV gain 25217958
nsv1050237 CNV loss 25217958
nsv1113749 CNV deletion 24896259
nsv1160333 CNV deletion 26073780

Variation tolerance for MGRN1 Gene

Residual Variation Intolerance Score: 19.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.80; 58.34% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for MGRN1 Gene

Human Gene Mutation Database (HGMD)
MGRN1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
MGRN1

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MGRN1 Gene

Disorders for MGRN1 Gene

Additional Disease Information for MGRN1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for MGRN1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for MGRN1 Gene

Publications for MGRN1 Gene

  1. Mahogunin ring finger-1 (MGRN1) E3 ubiquitin ligase inhibits signaling from melanocortin receptor by competition with Galphas. (PMID: 19737927) Pérez-Oliva AB … García-Borrón JC (The Journal of biological chemistry 2009) 3 4 23 56
  2. Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. (PMID: 9628581) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1998) 2 3 4 56
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 43 56
  4. Pigmentation-related genes and their implication in malignant melanoma susceptibility. (PMID: 19320733) Fernandez LP … Ribas G (Experimental dermatology 2009) 3 43 56
  5. Abnormal regulation of TSG101 in mice with spongiform neurodegeneration. (PMID: 19703557) Jiao J … Gunn TM (Biochimica et biophysica acta 2009) 3 4 56

Products for MGRN1 Gene

Sources for MGRN1 Gene