The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterati... See more...

Aliases for MGAT5 Gene

Aliases for MGAT5 Gene

  • Alpha-1,6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase 2 3 5
  • Alpha-1,6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase A 2 3 4
  • Mannosyl (Alpha-1,6-)-Glycoprotein Beta-1,6-N-Acetyl-Glucosaminyltransferase 2 3
  • Alpha-Mannoside Beta-1,6-N-Acetylglucosaminyltransferase V 3 4
  • Mannoside Acetylglucosaminyltransferase 5 3 4
  • N-Acetylglucosaminyl-Transferase V 3 4
  • EC 2.4.1.155 4 52
  • GlcNAc-T V 3 4
  • GNT-V 3 4
  • Alpha-Mannoside Beta-1,6-N-Acetylglucosaminyltransferase 3
  • GNT-VA 3
  • MGAT5A 3
  • GGNT5 4

External Ids for MGAT5 Gene

Previous GeneCards Identifiers for MGAT5 Gene

  • GC02P132654
  • GC02P133296
  • GC02P135031
  • GC02P135219
  • GC02P134842
  • GC02P134725
  • GC02P134594
  • GC02P127004

Summaries for MGAT5 Gene

Entrez Gene Summary for MGAT5 Gene

  • The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the activity of this enzyme has been correlated with the progression of invasive malignancies. [provided by RefSeq, Oct 2011]

GeneCards Summary for MGAT5 Gene

MGAT5 (Alpha-1,6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase) is a Protein Coding gene. Diseases associated with MGAT5 include Congenital Disorder Of Glycosylation, Type Iia and Hepatocellular Carcinoma. Among its related pathways are Metabolism of proteins and Transport to the Golgi and subsequent modification. Gene Ontology (GO) annotations related to this gene include acetylglucosaminyltransferase activity and alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity. An important paralog of this gene is MGAT5B.

UniProtKB/Swiss-Prot Summary for MGAT5 Gene

  • Catalyzes the addition of N-acetylglucosamine (GlcNAc) in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides (PubMed:10395745, PubMed:30140003). Catalyzes an important step in the biosynthesis of branched, complex-type N-glycans, such as those found on EGFR, TGFR (TGF-beta receptor) and CDH2 (PubMed:10395745, PubMed:22614033, PubMed:30140003). Via its role in the biosynthesis of complex N-glycans, plays an important role in the activation of cellular signaling pathways, reorganization of the actin cytoskeleton, cell-cell adhesion and cell migration. MGAT5-dependent EGFR N-glycosylation enhances the interaction between EGFR and LGALS3 and thereby prevents rapid EGFR endocytosis and prolongs EGFR signaling. Required for efficient interaction between TGFB1 and its receptor. Enhances activation of intracellular signaling pathways by several types of growth factors, including FGF2, PDGF, IGF, TGFB1 and EGF. MGAT5-dependent CDH2 N-glycosylation inhibits CDH2-mediated homotypic cell-cell adhesion and contributes to the regulation of downstream signaling pathways. Promotes cell migration. Contributes to the regulation of the inflammatory response. MGAT5-dependent TCR N-glycosylation enhances the interaction between TCR and LGALS3, limits agonist-induced TCR clustering, and thereby dampens TCR-mediated responses to antigens. Required for normal leukocyte evasation and accumulation at sites of inflammation (By similarity). Inhibits attachment of monocytes to the vascular endothelium and subsequent monocyte diapedesis (PubMed:22614033).
  • [Secreted alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A]: Promotes proliferation of umbilical vein endothelial cells and angiogenesis, at least in part by promoting the release of the growth factor FGF2 from the extracellular matrix.

Gene Wiki entry for MGAT5 Gene

Additional gene information for MGAT5 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for MGAT5 Gene

Genomics for MGAT5 Gene

GeneHancer (GH) Regulatory Elements for MGAT5 Gene

Promoters and enhancers for MGAT5 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH02J134117 Promoter/Enhancer 2.5 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 503.1 +2.2 2195 8.3 RXRA HNRNPK EP300 CTCF NRF1 POLR2G SP1 NCOR1 PHF8 FOS MGAT5 MIR3679 lnc-TMEM163-4
GH02J134245 Promoter/Enhancer 1.7 EPDnew Ensembl ENCODE dbSUPER 511.9 +130.3 130320 10 CTCF REST RELA MEF2C CTBP1 RAD21 TRIM22 SMC3 BCL11A TCF12 MGAT5 MAP3K19 RNA5SP104 piR-30876-061
GH02J134118 Enhancer 0.6 ENCODE 500.7 -2.0 -1995 0 TEAD1 CEBPG BCL6 KDM1A CEBPB HMG20A TEAD3 SOX5 HMG20B GATAD2A MGAT5 piR-39098-112
GH02J134256 Enhancer 1.1 FANTOM5 ENCODE dbSUPER 30.6 +140.4 140381 6.8 EP300 RELA MEF2C NR2F2 ZNF316 ZNF384 CTCF MEF2B ELF1 EBF1 MGAT5 RNA5SP104 piR-30876-061
GH02J134172 Enhancer 1.3 Ensembl ENCODE dbSUPER 21.1 +70.9 70891 36.8 ZNF217 EP300 CTCF JUND TEAD4 ZBTB5 REST POLR2A CUX1 CTBP1 MGAT5 MAP3K19 lnc-TMEM163-4 lnc-ACMSD-6
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around MGAT5 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for MGAT5

Top Transcription factor binding sites by QIAGEN in the MGAT5 gene promoter:
  • AML1a
  • AP-1
  • c-Fos
  • c-Jun
  • MIF-1
  • POU2F1
  • POU2F1a

Genomic Locations for MGAT5 Gene

Genomic Locations for MGAT5 Gene
chr2:134,119,930-134,454,621
(GRCh38/hg38)
Size:
334,692 bases
Orientation:
Plus strand
chr2:134,877,554-135,212,192
(GRCh37/hg19)
Size:
334,639 bases
Orientation:
Plus strand

Genomic View for MGAT5 Gene

Genes around MGAT5 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MGAT5 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MGAT5 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MGAT5 Gene

Proteins for MGAT5 Gene

  • Protein details for MGAT5 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q09328-MGT5A_HUMAN
    Recommended name:
    Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
    Protein Accession:
    Q09328
    Secondary Accessions:
    • D3DP70

    Protein attributes for MGAT5 Gene

    Size:
    741 amino acids
    Molecular mass:
    84543 Da
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for MGAT5 Gene

neXtProt entry for MGAT5 Gene

Selected DME Specific Peptides for MGAT5 Gene

Q09328:
  • KDILVPSF
  • NSTNSTTAVPSLV
  • CSFFIYLSEVENWCP
  • QEKCVLPPMDGYPHCEGKIKWMKDMWRSDPCYADYGVDG
  • LVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYL

Post-translational modifications for MGAT5 Gene

  • N-glycosylated.
  • A secreted form is released from the membrane after cleavage by gamma-secretase.
  • Glycosylation at Asn110, Asn115, Asn118, Asn334, Asn433, and Asn447
  • Modification sites at PhosphoSitePlus

Domains & Families for MGAT5 Gene

Gene Families for MGAT5 Gene

Protein Domains for MGAT5 Gene

InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for MGAT5 Gene

GenScript: Design optimal peptide antigens:
  • N-acetylglucosaminyl-transferase V (MGT5A_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q09328

UniProtKB/Swiss-Prot:

MGT5A_HUMAN :
  • Belongs to the glycosyltransferase 18 family.
Family:
  • Belongs to the glycosyltransferase 18 family.
genes like me logo Genes that share domains with MGAT5: view

Function for MGAT5 Gene

Molecular function for MGAT5 Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the addition of N-acetylglucosamine (GlcNAc) in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides (PubMed:10395745, PubMed:30140003). Catalyzes an important step in the biosynthesis of branched, complex-type N-glycans, such as those found on EGFR, TGFR (TGF-beta receptor) and CDH2 (PubMed:10395745, PubMed:22614033, PubMed:30140003). Via its role in the biosynthesis of complex N-glycans, plays an important role in the activation of cellular signaling pathways, reorganization of the actin cytoskeleton, cell-cell adhesion and cell migration. MGAT5-dependent EGFR N-glycosylation enhances the interaction between EGFR and LGALS3 and thereby prevents rapid EGFR endocytosis and prolongs EGFR signaling. Required for efficient interaction between TGFB1 and its receptor. Enhances activation of intracellular signaling pathways by several types of growth factors, including FGF2, PDGF, IGF, TGFB1 and EGF. MGAT5-dependent CDH2 N-glycosylation inhibits CDH2-mediated homotypic cell-cell adhesion and contributes to the regulation of downstream signaling pathways. Promotes cell migration. Contributes to the regulation of the inflammatory response. MGAT5-dependent TCR N-glycosylation enhances the interaction between TCR and LGALS3, limits agonist-induced TCR clustering, and thereby dampens TCR-mediated responses to antigens. Required for normal leukocyte evasation and accumulation at sites of inflammation (By similarity). Inhibits attachment of monocytes to the vascular endothelium and subsequent monocyte diapedesis (PubMed:22614033).
UniProtKB/Swiss-Prot Function:
[Secreted alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A]: Promotes proliferation of umbilical vein endothelial cells and angiogenesis, at least in part by promoting the release of the growth factor FGF2 from the extracellular matrix.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=N(4)-{beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAcl-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N(4)-{beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAcl-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP; Xref=Rhea:RHEA:16921, Rhea:RHEA-COMP:14374, Rhea:RHEA-COMP:14377, ChEBI:CHEBI:15378, ChEBI:CHEBI:57705, ChEBI:CHEBI:58223, ChEBI:CHEBI:139507, ChEBI:CHEBI:139510; EC=2.4.1.155; Evidence={ECO:0000269 PubMed:10395745, ECO:0000269 PubMed:17142794, ECO:0000269 PubMed:30140003};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activity is increased by Mn(2+) and Mg(2+).
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=6.78 mM for GlcNAc {ECO:0000269 PubMed:30140003}; KM=5.8 mM for GlcNAc {ECO:0000269 PubMed:10395745}; pH dependence: Optimum pH is 6.5. {ECO:0000269 PubMed:10395745}; Temperature dependence: Optimum temperature is 50 degrees Celsius. {ECO:0000269 PubMed:10395745};
UniProtKB/Swiss-Prot Induction:
Induced by IFNG treatment in monocytes (in vitro).
GENATLAS Biochemistry:
mannosyl (alpha-1,6-) glycoprotein beta-1,6-N-acetylglucosaminyltransferase,Golgi,biosynthesis of complex Asn-linked (N) glycans

Enzyme Numbers (IUBMB) for MGAT5 Gene

Phenotypes From GWAS Catalog for MGAT5 Gene

Gene Ontology (GO) - Molecular Function for MGAT5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004864 protein phosphatase inhibitor activity IDA 24846175
GO:0008375 acetylglucosaminyltransferase activity IEA --
GO:0016740 transferase activity IEA --
GO:0016757 transferase activity, transferring glycosyl groups IEA --
GO:0030144 alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity TAS --
genes like me logo Genes that share ontologies with MGAT5: view
genes like me logo Genes that share phenotypes with MGAT5: view

Animal Models for MGAT5 Gene

MGI Knock Outs for MGAT5:

Animal Model Products

CRISPR Products

miRNA for MGAT5 Gene

miRTarBase miRNAs that target MGAT5

Clone Products

  • Addgene plasmids for MGAT5

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MGAT5 Gene

Localization for MGAT5 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MGAT5 Gene

Golgi apparatus membrane; Single-pass type II membrane protein.
[Secreted alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A]: Secreted.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MGAT5 gene
Compartment Confidence
golgi apparatus 5
endoplasmic reticulum 3
plasma membrane 2
extracellular 2
cytoskeleton 1
mitochondrion 1
peroxisome 1
nucleus 1
endosome 1
cytosol 1
lysosome 1

Gene Ontology (GO) - Cellular Components for MGAT5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane TAS --
GO:0005576 extracellular region IEA --
GO:0005794 Golgi apparatus IBA 21873635
GO:0016020 membrane IEA,IDA 10395745
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with MGAT5: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for MGAT5 Gene

Pathways & Interactions for MGAT5 Gene

genes like me logo Genes that share pathways with MGAT5: view

UniProtKB/Swiss-Prot Q09328-MGT5A_HUMAN

  • Pathway: Protein modification; protein glycosylation.

Gene Ontology (GO) - Biological Process for MGAT5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006486 protein glycosylation IEA --
GO:0006487 protein N-linked glycosylation IDA 24846175
GO:0018279 protein N-linked glycosylation via asparagine IDA 10395745
GO:0030335 positive regulation of cell migration IDA 24846175
GO:1903614 negative regulation of protein tyrosine phosphatase activity IDA 24846175
genes like me logo Genes that share ontologies with MGAT5: view

No data available for SIGNOR curated interactions for MGAT5 Gene

Drugs & Compounds for MGAT5 Gene

(5) Drugs for MGAT5 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Uridine 5'-diphosphate Experimental Pharma 0

(13) Additional Compounds for MGAT5 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Uridine diphosphate-N-acetylglucosamine
  • (2R,3R,4R,5S,6R)-3-(acetylamino)-4,5-Dihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate (non-preferred name)
  • UDP-GlcNAc
  • UDP-N-Acetyl-D-glucosamine
  • UDP-N-Acetylglucosamine
  • URIDINE-diphosphATE-N-acetylglucosamine
528-04-1
genes like me logo Genes that share compounds with MGAT5: view

Transcripts for MGAT5 Gene

mRNA/cDNA for MGAT5 Gene

2 REFSEQ mRNAs :
10 NCBI additional mRNA sequence :
5 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Clone Products

  • Addgene plasmids for MGAT5

Alternative Splicing Database (ASD) splice patterns (SP) for MGAT5 Gene

No ASD Table

Relevant External Links for MGAT5 Gene

GeneLoc Exon Structure for
MGAT5

Expression for MGAT5 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for MGAT5 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for MGAT5 Gene

This gene is overexpressed in Testis (13.2), Heart (11.5), Placenta (11.1), Vitreous humor (10.8), and Urine (8.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for MGAT5 Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for MGAT5

SOURCE GeneReport for Unigene cluster for MGAT5 Gene:

Hs.4988

Evidence on tissue expression from TISSUES for MGAT5 Gene

  • Liver(4.2)
  • Nervous system(3.9)
  • Intestine(3.2)
  • Kidney(2.1)
genes like me logo Genes that share expression patterns with MGAT5: view

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for MGAT5 Gene

Orthologs for MGAT5 Gene

This gene was present in the common ancestor of animals.

Orthologs for MGAT5 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MGAT5 31 30
  • 99.87 (n)
OneToOne
dog
(Canis familiaris)
Mammalia MGAT5 31 30
  • 93.3 (n)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia MGAT5 31
  • 92 (a)
OneToOne
cow
(Bos Taurus)
Mammalia MGAT5 31 30
  • 90.66 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Mgat5 17 31 30
  • 88.92 (n)
rat
(Rattus norvegicus)
Mammalia Mgat5 30
  • 88.78 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia MGAT5 31
  • 81 (a)
OneToOne
chicken
(Gallus gallus)
Aves MGAT5 31 30
  • 79.9 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia MGAT5 31
  • 87 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia mgat5 30
  • 77.06 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.1926 30
zebrafish
(Danio rerio)
Actinopterygii mgat5 31 30
  • 71.97 (n)
OneToOne
Dr.12083 30
worm
(Caenorhabditis elegans)
Secernentea gly-2 31 30
  • 49.54 (n)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 42 (a)
OneToOne
Species where no ortholog for MGAT5 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for MGAT5 Gene

ENSEMBL:
Gene Tree for MGAT5 (if available)
TreeFam:
Gene Tree for MGAT5 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for MGAT5: view image

Paralogs for MGAT5 Gene

Paralogs for MGAT5 Gene

(2) SIMAP similar genes for MGAT5 Gene using alignment to 4 proteins:

  • MGT5A_HUMAN
  • Q53SM9_HUMAN
  • Q53SV8_HUMAN
  • Q53SZ9_HUMAN
genes like me logo Genes that share paralogs with MGAT5: view

Variants for MGAT5 Gene

Additional dbSNP identifiers (rs#s) for MGAT5 Gene

Structural Variations from Database of Genomic Variants (DGV) for MGAT5 Gene

Variant ID Type Subtype PubMed ID
dgv667n67 CNV loss 20364138
esv3368288 CNV insertion 20981092
esv3592553 CNV loss 21293372
nsv1004271 CNV loss 25217958
nsv1004843 CNV gain 25217958
nsv1008965 CNV loss 25217958
nsv1009691 CNV gain 25217958
nsv1142286 CNV tandem duplication 24896259
nsv478303 CNV novel sequence insertion 20440878
nsv508107 OTHER sequence alteration 20534489
nsv834385 CNV gain 17160897

Variation tolerance for MGAT5 Gene

Residual Variation Intolerance Score: 11.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.38; 27.26% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for MGAT5 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
MGAT5

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for MGAT5 Gene

Disorders for MGAT5 Gene

MalaCards: The human disease database

(2) MalaCards diseases for MGAT5 Gene - From: DISEASES, Novoseek, and GeneCards

- elite association - COSMIC cancer census association via MalaCards
Search MGAT5 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for MGAT5

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with MGAT5: view

No data available for UniProtKB/Swiss-Prot and Genatlas for MGAT5 Gene

Publications for MGAT5 Gene

  1. cDNA cloning and chromosomal mapping of human N-acetylglucosaminyltransferase V+. (PMID: 8292036) Saito H … Taniguchi N (Biochemical and biophysical research communications 1994) 2 3 4 23 54
  2. A secreted type of beta 1,6-N-acetylglucosaminyltransferase V (GnT-V) induces tumor angiogenesis without mediation of glycosylation: a novel function of GnT-V distinct from the original glycosyltransferase activity. (PMID: 11872751) Saito T … Taniguchi N (The Journal of biological chemistry 2002) 3 4 23 54
  3. Structure and mechanism of cancer-associated N-acetylglucosaminyltransferase-V. (PMID: 30140003) Nagae M … Yamaguchi Y (Nature communications 2018) 3 4 54
  4. N-acetylglucosaminyltransferase V negatively regulates integrin α5β1-mediated monocyte adhesion and transmigration through vascular endothelium. (PMID: 22614033) Yang HM … Yang Z (International journal of oncology 2012) 3 4 54
  5. MGAT5 and disease severity in progressive multiple sclerosis. (PMID: 21115203) Esposito F … Martinelli Boneschi F (Journal of neuroimmunology 2011) 3 41 54

Products for MGAT5 Gene

Sources for MGAT5 Gene