Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MGAT5 Gene

Aliases for MGAT5 Gene

  • Mannosyl (Alpha-1,6-)-Glycoprotein Beta-1,6-N-Acetyl-Glucosaminyltransferase 2 3 5
  • Alpha-Mannoside Beta-1,6-N-Acetylglucosaminyltransferase 3 4
  • Mannoside Acetylglucosaminyltransferase 5 3 4
  • N-Acetylglucosaminyl-Transferase V 3 4
  • EC 2.4.1.155 4 56
  • GlcNAc-T V 3 4
  • GNT-V 3 4
  • Alpha-1,6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase A 3
  • GNT-VA 3
  • GGNT5 4

External Ids for MGAT5 Gene

Previous GeneCards Identifiers for MGAT5 Gene

  • GC02P132654
  • GC02P133296
  • GC02P135031
  • GC02P135219
  • GC02P134842
  • GC02P134725
  • GC02P134594
  • GC02P127004

Summaries for MGAT5 Gene

Entrez Gene Summary for MGAT5 Gene

  • The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the activity of this enzyme has been correlated with the progression of invasive malignancies. [provided by RefSeq, Oct 2011]

GeneCards Summary for MGAT5 Gene

MGAT5 (Mannosyl (Alpha-1,6-)-Glycoprotein Beta-1,6-N-Acetyl-Glucosaminyltransferase) is a Protein Coding gene. Diseases associated with MGAT5 include Hepatocellular Carcinoma and Bile Duct Carcinoma. Among its related pathways are Metabolism of proteins and Transport to the Golgi and subsequent modification. Gene Ontology (GO) annotations related to this gene include acetylglucosaminyltransferase activity and alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity. An important paralog of this gene is MGAT5B.

UniProtKB/Swiss-Prot for MGAT5 Gene

  • Catalyzes the addition of N-acetylglucosamine in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides.

Gene Wiki entry for MGAT5 Gene

Additional gene information for MGAT5 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MGAT5 Gene

Genomics for MGAT5 Gene

GeneHancer (GH) Regulatory Elements for MGAT5 Gene

Promoters and enhancers for MGAT5 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH02I134117 Promoter/Enhancer 2.1 FANTOM5 Ensembl ENCODE dbSUPER 553.2 +0.1 90 4.1 PKNOX1 SMAD1 ARNT ARID4B SIN3A DMAP1 ZNF2 IRF4 YY1 ZNF766 MGAT5 MIR3679
GH02I134245 Promoter/Enhancer 1.7 EPDnew Ensembl ENCODE dbSUPER 561.9 +130.3 130291 10 HDGF PKNOX1 ZBTB40 BATF IRF4 RAD21 SCRT2 ZNF143 ATF7 ETV6 MGAT5 MAP3K19 RNA5SP104 GC02M134321
GH02I134118 Enhancer 0.6 ENCODE 550.8 -2.0 -1995 0 CTCF SOX5 SOX13 GATAD2A HMG20B CEBPB BCL6 CEBPG MGAT5 GC02M133943
GH02I134256 Enhancer 1.3 FANTOM5 Ensembl ENCODE dbSUPER 30.6 +140.4 140381 6.8 CTCF EBF1 ELF1 NR2F2 RELA ZNF316 POLR2A IKZF1 ZFP36 HNF4A MGAT5 RNA5SP104 GC02M134321
GH02I134231 Enhancer 1.2 Ensembl ENCODE dbSUPER 19.9 +113.8 113839 5.3 HDGF SOX13 FOXA2 EBF1 CEBPG BATF IRF4 NFATC1 RCOR1 ATF7 MGAT5 RNA5SP104 GC02M134321
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around MGAT5 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the MGAT5 gene promoter:

Genomic Locations for MGAT5 Gene

Genomic Locations for MGAT5 Gene
chr2:134,119,930-134,454,621
(GRCh38/hg38)
Size:
334,692 bases
Orientation:
Plus strand
chr2:134,877,554-135,212,192
(GRCh37/hg19)

Genomic View for MGAT5 Gene

Genes around MGAT5 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MGAT5 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MGAT5 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MGAT5 Gene

Proteins for MGAT5 Gene

  • Protein details for MGAT5 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q09328-MGT5A_HUMAN
    Recommended name:
    Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
    Protein Accession:
    Q09328
    Secondary Accessions:
    • D3DP70

    Protein attributes for MGAT5 Gene

    Size:
    741 amino acids
    Molecular mass:
    84543 Da
    Quaternary structure:
    No Data Available

neXtProt entry for MGAT5 Gene

Selected DME Specific Peptides for MGAT5 Gene

Q09328:
  • KDILVPSF
  • NSTNSTTAVPSLV
  • CSFFIYLSEVENWCP
  • QEKCVLPPMDGYPHCEGKIKWMKDMWRSDPCYADYGVDG
  • LVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYL

Post-translational modifications for MGAT5 Gene

  • Glycosylation at isoforms=110, posLast=115115, isoforms=118, posLast=334334, posLast=433433, and isoforms=447

Domains & Families for MGAT5 Gene

Gene Families for MGAT5 Gene

Protein Domains for MGAT5 Gene

InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for MGAT5 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q09328

UniProtKB/Swiss-Prot:

MGT5A_HUMAN :
  • Belongs to the glycosyltransferase 18 family.
Family:
  • Belongs to the glycosyltransferase 18 family.
genes like me logo Genes that share domains with MGAT5: view

Function for MGAT5 Gene

Molecular function for MGAT5 Gene

GENATLAS Biochemistry:
mannosyl (alpha-1,6-) glycoprotein beta-1,6-N-acetylglucosaminyltransferase,Golgi,biosynthesis of complex Asn-linked (N) glycans
UniProtKB/Swiss-Prot CatalyticActivity:
UDP-N-acetyl-D-glucosamine + 6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R = UDP + 6-(2,6-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R.
UniProtKB/Swiss-Prot Function:
Catalyzes the addition of N-acetylglucosamine in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides.

Enzyme Numbers (IUBMB) for MGAT5 Gene

Phenotypes From GWAS Catalog for MGAT5 Gene

Gene Ontology (GO) - Molecular Function for MGAT5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0008375 acetylglucosaminyltransferase activity IEA --
GO:0016740 transferase activity IEA --
GO:0016757 transferase activity, transferring glycosyl groups IEA --
GO:0030144 alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity TAS --
genes like me logo Genes that share ontologies with MGAT5: view
genes like me logo Genes that share phenotypes with MGAT5: view

Animal Models for MGAT5 Gene

MGI Knock Outs for MGAT5:

miRNA for MGAT5 Gene

miRTarBase miRNAs that target MGAT5

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MGAT5 Gene

Localization for MGAT5 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MGAT5 Gene

Golgi apparatus membrane; Single-pass type II membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MGAT5 gene
Compartment Confidence
extracellular 5
golgi apparatus 5
plasma membrane 2
endoplasmic reticulum 2
mitochondrion 1
peroxisome 1
lysosome 1

Gene Ontology (GO) - Cellular Components for MGAT5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane TAS --
GO:0005794 Golgi apparatus IBA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
GO:0070062 extracellular exosome HDA,IDA 23376485
genes like me logo Genes that share ontologies with MGAT5: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for MGAT5 Gene

Pathways & Interactions for MGAT5 Gene

genes like me logo Genes that share pathways with MGAT5: view

UniProtKB/Swiss-Prot Q09328-MGT5A_HUMAN

  • Pathway: Protein modification; protein glycosylation.

Interacting Proteins for MGAT5 Gene

Gene Ontology (GO) - Biological Process for MGAT5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006486 protein glycosylation IEA --
GO:0006487 protein N-linked glycosylation IBA --
genes like me logo Genes that share ontologies with MGAT5: view

No data available for SIGNOR curated interactions for MGAT5 Gene

Drugs & Compounds for MGAT5 Gene

(5) Drugs for MGAT5 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Uridine-5'-Diphosphate Experimental Pharma 0

(13) Additional Compounds for MGAT5 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Uridine diphosphate-N-acetylglucosamine
  • N-[2-[[[5-[(2,4-Dioxo-1H-pyrimidin-1-yl)]-3,4-dihydroxy-tetrahydrofuran-2-yl]methoxy-hydroxy-phosphinoyl]oxy-hydroxy-phosphinoyl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]acetamide
  • UDP-a-D-N-Acetylglucosamine
  • UDP-Acetyl-D-glucosamine
  • UDP-Acetyl-delta-glucosamine
  • UDP-Acetylglucosamine
528-04-1
genes like me logo Genes that share compounds with MGAT5: view

Transcripts for MGAT5 Gene

Unigene Clusters for MGAT5 Gene

Mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for MGAT5 Gene

No ASD Table

Relevant External Links for MGAT5 Gene

GeneLoc Exon Structure for
MGAT5
ECgene alternative splicing isoforms for
MGAT5

Expression for MGAT5 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for MGAT5 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for MGAT5 Gene

This gene is overexpressed in Testis (13.2), Heart (11.5), Placenta (11.1), Vitreous humor (10.8), and Urine (8.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MGAT5 Gene



NURSA nuclear receptor signaling pathways regulating expression of MGAT5 Gene:

MGAT5

SOURCE GeneReport for Unigene cluster for MGAT5 Gene:

Hs.4988

Evidence on tissue expression from TISSUES for MGAT5 Gene

  • Liver(4.2)
  • Nervous system(3.9)
  • Intestine(3.2)
  • Kidney(2.1)
genes like me logo Genes that share expression patterns with MGAT5: view

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for MGAT5 Gene

Orthologs for MGAT5 Gene

This gene was present in the common ancestor of animals.

Orthologs for MGAT5 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MGAT5 33 34
  • 99.87 (n)
dog
(Canis familiaris)
Mammalia MGAT5 33 34
  • 93.3 (n)
oppossum
(Monodelphis domestica)
Mammalia MGAT5 34
  • 92 (a)
OneToOne
cow
(Bos Taurus)
Mammalia MGAT5 33 34
  • 90.66 (n)
mouse
(Mus musculus)
Mammalia Mgat5 33 16 34
  • 88.92 (n)
rat
(Rattus norvegicus)
Mammalia Mgat5 33
  • 88.78 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia MGAT5 34
  • 81 (a)
OneToOne
chicken
(Gallus gallus)
Aves MGAT5 33 34
  • 79.9 (n)
lizard
(Anolis carolinensis)
Reptilia MGAT5 34
  • 87 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia mgat5 33
  • 77.06 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.1926 33
zebrafish
(Danio rerio)
Actinopterygii mgat5 33 34
  • 71.97 (n)
Dr.12083 33
worm
(Caenorhabditis elegans)
Secernentea gly-2 33 34
  • 49.54 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 42 (a)
OneToOne
Species where no ortholog for MGAT5 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for MGAT5 Gene

ENSEMBL:
Gene Tree for MGAT5 (if available)
TreeFam:
Gene Tree for MGAT5 (if available)

Paralogs for MGAT5 Gene

Paralogs for MGAT5 Gene

(2) SIMAP similar genes for MGAT5 Gene using alignment to 4 proteins:

genes like me logo Genes that share paralogs with MGAT5: view

Variants for MGAT5 Gene

Sequence variations from dbSNP and Humsavar for MGAT5 Gene

SNP ID Clin Chr 02 pos Variation AA Info Type
rs1000016396 -- 134,453,289(+) G/C 3_prime_UTR_variant, genic_downstream_transcript_variant
rs1000019798 -- 134,137,703(+) A/G genic_upstream_transcript_variant, intron_variant
rs1000038728 -- 134,229,971(+) A/G genic_upstream_transcript_variant, intron_variant
rs1000040704 -- 134,265,292(+) A/G intron_variant
rs1000042449 -- 134,321,622(+) G/A intron_variant

Structural Variations from Database of Genomic Variants (DGV) for MGAT5 Gene

Variant ID Type Subtype PubMed ID
nsv834385 CNV gain 17160897
nsv508107 OTHER sequence alteration 20534489
nsv478303 CNV novel sequence insertion 20440878
nsv1142286 CNV tandem duplication 24896259
nsv1009691 CNV gain 25217958
nsv1008965 CNV loss 25217958
nsv1004843 CNV gain 25217958
nsv1004271 CNV loss 25217958
esv3592553 CNV loss 21293372
esv3368288 CNV insertion 20981092
dgv667n67 CNV loss 20364138

Variation tolerance for MGAT5 Gene

Residual Variation Intolerance Score: 11.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.38; 27.26% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for MGAT5 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
MGAT5

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MGAT5 Gene

Disorders for MGAT5 Gene

MalaCards: The human disease database

(2) MalaCards diseases for MGAT5 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
hepatocellular carcinoma
  • hcc
bile duct carcinoma
  • carcinoma of extrahepatic bile duct
- elite association - COSMIC cancer census association via MalaCards
Search MGAT5 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for MGAT5

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with MGAT5: view

No data available for UniProtKB/Swiss-Prot and Genatlas for MGAT5 Gene

Publications for MGAT5 Gene

  1. cDNA cloning and chromosomal mapping of human N-acetylglucosaminyltransferase V+. (PMID: 8292036) Saito H … Taniguchi N (Biochemical and biophysical research communications 1994) 2 3 4 22 58
  2. MGAT5 and disease severity in progressive multiple sclerosis. (PMID: 21115203) Esposito F … Martinelli Boneschi F (Journal of neuroimmunology 2011) 3 44 58
  3. Comparison of the substrate specificities and catalytic properties of the sister N-acetylglucosaminyltransferases, GnT-V and GnT-Vb (IX). (PMID: 19846580) Alvarez-Manilla G … Pierce M (Glycobiology 2010) 3 22 58
  4. Confirmation of genomewide association signals in Chinese Han population reveals risk loci for ischemic stroke. (PMID: 19910543) Ding H … Wang DW (Stroke 2010) 3 44 58
  5. Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts. (PMID: 20468071) Dick DM … Bierut L (American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2010) 3 44 58

Products for MGAT5 Gene

Sources for MGAT5 Gene

Content
Loading form....