Aliases for MGAT5 Gene
Aliases for MGAT5 Gene
External Ids for MGAT5 Gene
- HGNC: 7049
- Entrez Gene: 4249
- Ensembl: ENSG00000152127
- OMIM: 601774
- UniProtKB: Q09328
Previous GeneCards Identifiers for MGAT5 Gene
- GC02P132654
- GC02P133296
- GC02P135031
- GC02P135219
- GC02P134842
- GC02P134725
- GC02P134594
- GC02P127004
Summaries for MGAT5 Gene
-
The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the activity of this enzyme has been correlated with the progression of invasive malignancies. [provided by RefSeq, Oct 2011]
GeneCards Summary for MGAT5 Gene
MGAT5 (Mannosyl (Alpha-1,6-)-Glycoprotein Beta-1,6-N-Acetyl-Glucosaminyltransferase) is a Protein Coding gene. Diseases associated with MGAT5 include Hepatocellular Carcinoma and Bile Duct Carcinoma. Among its related pathways are Metabolism of proteins and Transport to the Golgi and subsequent modification. Gene Ontology (GO) annotations related to this gene include acetylglucosaminyltransferase activity and alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity. An important paralog of this gene is MGAT5B.
UniProtKB/Swiss-Prot for MGAT5 Gene
-
Catalyzes the addition of N-acetylglucosamine in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides.
Additional gene information for MGAT5 Gene
- Monarch Initiative
- Search for MGAT5 at DataMed
- Search for MGAT5 at HumanCyc
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MGAT5 Gene
Genomics for MGAT5 Gene
GeneHancer (GH) Regulatory Elements for MGAT5 Gene
Promoters and enhancers for MGAT5 Gene
| GeneHancer (GH) Identifier | GH Type | GH Score |
GH Sources | Gene Association Score | Total Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites |
Gene Targets |
|---|---|---|---|---|---|---|---|---|---|---|
| GH02I134117 | Promoter/Enhancer | 2.1 | FANTOM5 Ensembl ENCODE dbSUPER | 553.2 | +0.1 | 90 | 4.1 | PKNOX1 SMAD1 ARNT ARID4B SIN3A DMAP1 ZNF2 IRF4 YY1 ZNF766 | MGAT5 MIR3679 | |
| GH02I134245 | Promoter/Enhancer | 1.7 | EPDnew Ensembl ENCODE dbSUPER | 561.9 | +130.3 | 130291 | 10 | HDGF PKNOX1 ZBTB40 BATF IRF4 RAD21 SCRT2 ZNF143 ATF7 ETV6 | MGAT5 MAP3K19 RNA5SP104 GC02M134321 | |
| GH02I134118 | Enhancer | 0.6 | ENCODE | 550.8 | -2.0 | -1995 | 0 | CTCF SOX5 SOX13 GATAD2A HMG20B CEBPB BCL6 CEBPG | MGAT5 GC02M133943 | |
| GH02I134256 | Enhancer | 1.3 | FANTOM5 Ensembl ENCODE dbSUPER | 30.6 | +140.4 | 140381 | 6.8 | CTCF EBF1 ELF1 NR2F2 RELA ZNF316 POLR2A IKZF1 ZFP36 HNF4A | MGAT5 RNA5SP104 GC02M134321 | |
| GH02I134231 | Enhancer | 1.2 | Ensembl ENCODE dbSUPER | 19.9 | +113.8 | 113839 | 5.3 | HDGF SOX13 FOXA2 EBF1 CEBPG BATF IRF4 NFATC1 RCOR1 ATF7 | MGAT5 RNA5SP104 GC02M134321 |
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around MGAT5 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Locations for MGAT5 Gene
Genomic Locations for MGAT5 Gene
- chr2:134,119,930-134,454,621
- (GRCh38/hg38)
- Size:
- 334,692 bases
- Orientation:
- Plus strand
- chr2:134,877,554-135,212,192
- (GRCh37/hg19)
Genomic View for MGAT5 Gene
Genes around MGAT5 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 2q21.2 by Ensembl
- 2q21.2-q21.3 by Entrez Gene
- 2q21.2-q21.3 by HGNC
MGAT5 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for MGAT5 Gene
Proteins for MGAT5 Gene
-
Protein details for MGAT5 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q09328-MGT5A_HUMAN
- Recommended name:
- Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
- Protein Accession:
- Q09328
- D3DP70
Protein attributes for MGAT5 Gene
- Size:
- 741 amino acids
- Molecular mass:
- 84543 Da
- Quaternary structure:
- No Data Available
Protein Expression for MGAT5 Gene
Selected DME Specific Peptides for MGAT5 Gene
- Q09328:
-
- KDILVPSF
- NSTNSTTAVPSLV
- CSFFIYLSEVENWCP
- QEKCVLPPMDGYPHCEGKIKWMKDMWRSDPCYADYGVDG
- LVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYL
Post-translational modifications for MGAT5 Gene
- Glycosylation at isoforms=110, posLast=115115, isoforms=118, posLast=334334, posLast=433433, and isoforms=447
Other Protein References for MGAT5 Gene
Antibody Products
- R&D Systems Antibodies for MGAT5 (N-Acetylglucosaminyltransferase V/MGAT5)
- Novus Biologicals Antibodies for MGAT5
-
Abcam antibodies for MGAT5
- Invitrogen Antibodies for MGAT5
- Search GeneTex for Antibodies for MGAT5
-
Santa Cruz Biotechnology (SCBT) Antibodies for MGAT5
Protein Products
- R&D Systems Proteins and Enzymes for MGAT5 (N-Acetylglucosaminyltransferase V/MGAT5)
- Search Origene for Purified Proteins, MassSpec and Protein Over-expression Lysates for MGAT5
- Origene Custom Protein Services for MGAT5
- Novus Biologicals proteins for MGAT5
- Sino Biological Cell Lysates for MGAT5
- Sino Biological Recombinant Proteins for MGAT5
- antibodies-online: Search results for 6 available MGAT5 Proteins ranked by validation data
- Compare Top MGAT5 Proteins
-
Quality Products:
- Search GeneTex for Proteins for MGAT5
-
Abcam proteins for MGAT5
Assay Products
-
Cloud-Clone Corp. Assay Kits for MGAT5
Domains & Families for MGAT5 Gene
Gene Families for MGAT5 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted membrane proteins
Protein Domains for MGAT5 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for MGAT5 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q09328- Family:
-
- Belongs to the glycosyltransferase 18 family.
Function for MGAT5 Gene
Molecular function for MGAT5 Gene
- GENATLAS Biochemistry:
- mannosyl (alpha-1,6-) glycoprotein beta-1,6-N-acetylglucosaminyltransferase,Golgi,biosynthesis of complex Asn-linked (N) glycans
- UniProtKB/Swiss-Prot CatalyticActivity:
- UDP-N-acetyl-D-glucosamine + 6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R = UDP + 6-(2,6-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R.
- UniProtKB/Swiss-Prot Function:
- Catalyzes the addition of N-acetylglucosamine in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides.
Enzyme Numbers (IUBMB) for MGAT5 Gene
Phenotypes From GWAS Catalog for MGAT5 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0008375 | acetylglucosaminyltransferase activity | IEA | -- |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0016757 | transferase activity, transferring glycosyl groups | IEA | -- |
| GO:0030144 | alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity | TAS | -- |
Phenotypes for MGAT5 Gene
- MGI mutant phenotypes for MGAT5:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for MGAT5:
Animal Models for MGAT5 Gene
- MGI Knock Outs for MGAT5:
-
- Mgat5 tm1Jwd
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for MGAT5
-
-
ViGene Biosciences lentiviral particle packaged cDNA for MGAT5 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for MGAT5 gene
- Search ViGene Biosciences for MGAT5
CRISPR Products
-
OriGene CRISPR knockouts for MGAT5
- genomics-online: gRNA clones - Search results for 89 available MGAT5 gene related products
- Overview of 89 available MGAT5 gene related products
- Applied Biological Materials CRISPR for MGAT5
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for MGAT5
- GenScript: Design CRISPR guide RNA sequences for MGAT5
miRNA for MGAT5 Gene
- miRTarBase miRNAs that target MGAT5
-
- hsa-mir-502-3p (MIRT037984)
- hsa-mir-769-5p (MIRT039157)
- hsa-mir-181a-5p (MIRT047339)
- hsa-mir-23c (MIRT485405)
- hsa-mir-23b-3p (MIRT485406)
- hsa-mir-23a-3p (MIRT485407)
- hsa-mir-130a-5p (MIRT485408)
- hsa-mir-7847-3p (MIRT485409)
- hsa-mir-6894-5p (MIRT485410)
- hsa-mir-765 (MIRT485411)
- hsa-mir-7154-3p (MIRT485412)
- hsa-mir-766-5p (MIRT485413)
- hsa-mir-5189-3p (MIRT485414)
- hsa-mir-6511b-3p (MIRT541793)
- hsa-mir-6511a-3p (MIRT541794)
- hsa-mir-3680-5p (MIRT541795)
- hsa-mir-603 (MIRT541796)
- hsa-mir-8485 (MIRT541797)
- hsa-mir-7850-5p (MIRT623249)
- hsa-mir-4529-3p (MIRT623250)
- hsa-mir-4520-2-3p (MIRT623251)
- hsa-mir-8058 (MIRT623252)
- hsa-mir-5009-5p (MIRT623253)
- hsa-mir-1269b (MIRT623254)
- hsa-mir-1269a (MIRT623255)
- hsa-mir-3121-5p (MIRT623256)
- hsa-mir-4279 (MIRT656209)
- hsa-mir-6881-3p (MIRT656210)
- hsa-mir-5581-3p (MIRT656211)
- hsa-mir-1236-3p (MIRT656212)
- hsa-mir-6845-3p (MIRT656213)
- hsa-mir-3667-3p (MIRT656214)
- hsa-mir-877-3p (MIRT656215)
- hsa-mir-5685 (MIRT656216)
- hsa-mir-6872-3p (MIRT656217)
- hsa-mir-4690-3p (MIRT656218)
- hsa-mir-6743-5p (MIRT656219)
- hsa-mir-4688 (MIRT656220)
- hsa-mir-6768-5p (MIRT656221)
- hsa-mir-5681a (MIRT656222)
- hsa-mir-6891-3p (MIRT656223)
- hsa-mir-6072 (MIRT656224)
- hsa-mir-6738-3p (MIRT667404)
- hsa-mir-5001-3p (MIRT667405)
- hsa-mir-6886-3p (MIRT667406)
- hsa-mir-938 (MIRT667407)
- hsa-mir-6505-3p (MIRT667408)
- hsa-mir-324-3p (MIRT667409)
- hsa-mir-1913 (MIRT667410)
- hsa-mir-539-3p (MIRT687560)
- hsa-mir-485-3p (MIRT687561)
- hsa-mir-3941 (MIRT687562)
- hsa-mir-362-3p (MIRT687563)
- hsa-mir-329-3p (MIRT687564)
- hsa-mir-629-3p (MIRT712401)
- hsa-mir-29b-2-5p (MIRT712402)
- hsa-mir-6855-5p (MIRT712403)
- hsa-mir-3170 (MIRT712404)
- hsa-mir-519e-5p (MIRT712405)
- hsa-mir-515-5p (MIRT712406)
- hsa-mir-6742-5p (MIRT712407)
- hsa-mir-92a-2-5p (MIRT712408)
- hsa-mir-6766-5p (MIRT712409)
- hsa-mir-6756-5p (MIRT712410)
- hsa-mir-193b-5p (MIRT712411)
- hsa-mir-3925-3p (MIRT712412)
- hsa-mir-766-3p (MIRT712413)
- hsa-mir-665 (MIRT712414)
- hsa-mir-4459 (MIRT712415)
- hsa-mir-4695-5p (MIRT712416)
- hsa-mir-3155a (MIRT784690)
- hsa-mir-3155b (MIRT784693)
- hsa-mir-4438 (MIRT785879)
- hsa-mir-484 (MIRT786871)
miRNA Products
- Search ViGene Biosciences for MGAT5
Inhibitory RNA Products
- Origene RNAi and shrna products in human, mouse, rat for MGAT5
- Browse OriGene Inhibitory RNA Products For MGAT5
- genomics-online: shRNA clones - Search results for 89 available MGAT5 gene related products
- Overview of 89 available MGAT5 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for MGAT5 gene
Clone Products
- Sino Biological Human cDNA Clone for MGAT5
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for MGAT5
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MGAT5
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for MGAT5
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for MGAT5
-
ViGene Biosciences adenoviral particle packaged cDNA for MGAT5 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for MGAT5 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for MGAT5 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MGAT5 Gene
Localization for MGAT5 Gene
Subcellular locations from UniProtKB/Swiss-Prot for MGAT5 Gene
- Golgi apparatus membrane; Single-pass type II membrane protein.
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| golgi apparatus | 5 |
| plasma membrane | 2 |
| endoplasmic reticulum | 2 |
| mitochondrion | 1 |
| peroxisome | 1 |
| lysosome | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000139 | Golgi membrane | TAS | -- |
| GO:0005794 | Golgi apparatus | IBA | -- |
| GO:0016020 | membrane | IEA | -- |
| GO:0016021 | integral component of membrane | IEA | -- |
| GO:0070062 | extracellular exosome | HDA,IDA | 23376485 |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for MGAT5 Gene
Pathways & Interactions for MGAT5 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Transport to the Golgi and subsequent modification | ||
| 2 | Metabolism of proteins | ||
| 3 | N-glycan antennae elongation in the medial/trans-Golgi | ||
| 4 | Metabolism | ||
| 5 | N-Glycan biosynthesis | ||
Pathways by source for MGAT5 Gene
2 KEGG pathways for MGAT5 Gene
UniProtKB/Swiss-Prot Q09328-MGT5A_HUMAN
- Pathway: Protein modification; protein glycosylation.
Interacting Proteins for MGAT5 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006486 | protein glycosylation | IEA | -- |
| GO:0006487 | protein N-linked glycosylation | IBA | -- |
No data available for SIGNOR curated interactions for MGAT5 Gene
Drugs & Compounds for MGAT5 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Uridine-5'-Diphosphate | Experimental | Pharma | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| Uridine diphosphate-N-acetylglucosamine |
|
528-04-1 |
|
Transcripts for MGAT5 Gene
mRNA/cDNA for MGAT5 Gene
- (13) REFSEQ mRNAs :
- (7) Additional mRNA sequences :
- (309) Selected AceView cDNA sequences:
- (5) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for MGAT5 Gene
CRISPR Products
-
OriGene CRISPR knockouts for MGAT5
- genomics-online: gRNA clones - Search results for 89 available MGAT5 gene related products
- Overview of 89 available MGAT5 gene related products
- Applied Biological Materials CRISPR for MGAT5
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for MGAT5
- GenScript: Design CRISPR guide RNA sequences for MGAT5
miRNA Products
- Search ViGene Biosciences for MGAT5
Inhibitory RNA Products
- Origene RNAi and shrna products in human, mouse, rat for MGAT5
- Browse OriGene Inhibitory RNA Products For MGAT5
- genomics-online: shRNA clones - Search results for 89 available MGAT5 gene related products
- Overview of 89 available MGAT5 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for MGAT5 gene
Clone Products
- Sino Biological Human cDNA Clone for MGAT5
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for MGAT5
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MGAT5
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for MGAT5
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Expression for MGAT5 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Neural Tube (Nervous System)
- Brain (Nervous System)
- Kidney (Urinary System)
-
Blood (Hematopoietic System)
- Natural Killer Cells Peripheral Blood
This gene is overexpressed in Testis (13.2), Heart (11.5), Placenta (11.1), Vitreous humor (10.8), and Urine (8.3).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MGAT5 Gene
NURSA nuclear receptor signaling pathways regulating expression of MGAT5 Gene:
MGAT5SOURCE GeneReport for Unigene cluster for MGAT5 Gene:
Hs.4988Evidence on tissue expression from TISSUES for MGAT5 Gene
- Liver(4.2)
- Nervous system(3.9)
- Intestine(3.2)
- Kidney(2.1)
Primer Products
-
OriGene qPCR primer pairs for MGAT5
- genomics-online: primer clones - Search results for 89 available MGAT5 gene related products
- Overview of 89 available MGAT5 gene related products
No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for MGAT5 Gene
Orthologs for MGAT5 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | MGAT5 33 34 |
|
||
| dog (Canis familiaris) |
Mammalia | MGAT5 33 34 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | MGAT5 34 |
|
OneToOne | |
| cow (Bos Taurus) |
Mammalia | MGAT5 33 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Mgat5 33 16 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Mgat5 33 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | MGAT5 34 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | MGAT5 33 34 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | MGAT5 34 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | mgat5 33 |
|
||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.1926 33 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | mgat5 33 34 |
|
||
| Dr.12083 33 |
|
||||
| worm (Caenorhabditis elegans) |
Secernentea | gly-2 33 34 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToOne |
- Species where no ortholog for MGAT5 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- fruit fly (Drosophila melanogaster)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for MGAT5 Gene
(2) SIMAP similar genes for MGAT5 Gene using alignment to 4 proteins:
Variants for MGAT5 Gene
| SNP ID | Clin | Chr 02 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1000016396 | -- | 134,453,289(+) | G/C | 3_prime_UTR_variant, genic_downstream_transcript_variant | |
| rs1000019798 | -- | 134,137,703(+) | A/G | genic_upstream_transcript_variant, intron_variant | |
| rs1000038728 | -- | 134,229,971(+) | A/G | genic_upstream_transcript_variant, intron_variant | |
| rs1000040704 | -- | 134,265,292(+) | A/G | intron_variant | |
| rs1000042449 | -- | 134,321,622(+) | G/A | intron_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| nsv834385 | CNV | gain | 17160897 |
| nsv508107 | OTHER | sequence alteration | 20534489 |
| nsv478303 | CNV | novel sequence insertion | 20440878 |
| nsv1142286 | CNV | tandem duplication | 24896259 |
| nsv1009691 | CNV | gain | 25217958 |
| nsv1008965 | CNV | loss | 25217958 |
| nsv1004843 | CNV | gain | 25217958 |
| nsv1004271 | CNV | loss | 25217958 |
| esv3592553 | CNV | loss | 21293372 |
| esv3368288 | CNV | insertion | 20981092 |
| dgv667n67 | CNV | loss | 20364138 |
Residual Variation Intolerance Score:
11.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.38;
27.26% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for MGAT5 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- MGAT5
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MGAT5 Gene
Disorders for MGAT5 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| hepatocellular carcinoma |
|
|
| bile duct carcinoma |
|
|
Search MGAT5 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for MGAT5
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for MGAT5 Gene
Publications for MGAT5 Gene
- cDNA cloning and chromosomal mapping of human N-acetylglucosaminyltransferase V+. (PMID: 8292036) Saito H … Taniguchi N (Biochemical and biophysical research communications 1994) 2 3 4 22 58
- MGAT5 and disease severity in progressive multiple sclerosis. (PMID: 21115203) Esposito F … Martinelli Boneschi F (Journal of neuroimmunology 2011) 3 44 58
- Comparison of the substrate specificities and catalytic properties of the sister N-acetylglucosaminyltransferases, GnT-V and GnT-Vb (IX). (PMID: 19846580) Alvarez-Manilla G … Pierce M (Glycobiology 2010) 3 22 58
- Confirmation of genomewide association signals in Chinese Han population reveals risk loci for ischemic stroke. (PMID: 19910543) Ding H … Wang DW (Stroke 2010) 3 44 58
- Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts. (PMID: 20468071) Dick DM … Bierut L (American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2010) 3 44 58
Products for MGAT5 Gene
- R&D Systems Antibodies for MGAT5 (N-Acetylglucosaminyltransferase V/MGAT5)
- R&D Systems Proteins and Enzymes for MGAT5 (N-Acetylglucosaminyltransferase V/MGAT5)
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Browse OriGene Antibodies
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for Purified Proteins, MassSpec and Protein Over-expression Lysates for MGAT5
- Origene Custom Protein Services for MGAT5
- Origene shrna and RNAi products in human, mouse, rat for MGAT5
- Browse OriGene Inhibitory RNA Products For MGAT5
- OriGene qPCR primer pairs for MGAT5
- OriGene CRISPR knockouts for MGAT5
- OriGene ORF clones in human for MGAT5
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For MGAT5
- GenScript: Next-day shipping of latest version cDNA ORF clones for MGAT5 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for MGAT5
- GenScript Custom Assay Services for MGAT5
- GenScript Custom overexpressing Cell Line Services for MGAT5
- GenScript: Design CRISPR guide RNA sequences for MGAT5
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for MGAT5
- Sino Biological Human cDNA Clone for MGAT5
- Sino Biological Cell Lysates for MGAT5
- Sino Biological Recombinant Proteins for MGAT5
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for MGAT5
- Novus Biologicals proteins for MGAT5
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for MGAT5
- Abcam proteins for MGAT5
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Cloud-Clone Corp. Assay Kits for MGAT5
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for MGAT5
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for MGAT5
- VectorBuilder custom plasmid, inducible vectors for MGAT5
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MGAT5
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 49 available MGAT5 Antibodies ranked by validation data
- Compare Top MGAT5 Antibodies
- Quality Products:
- antibodies-online: Search results for 14 available MGAT5 Elisa Kits ranked by validation data
- Compare Top MGAT5 Elisa Kits
- antibodies-online: Search results for 6 available MGAT5 Proteins ranked by validation data
- Compare Top MGAT5 Proteins
- Quality Products:
- Search GeneTex for Antibodies for MGAT5
- Search GeneTex for Proteins for MGAT5
- ViGene Biosciences adenoviral particle packaged cDNA for MGAT5 gene
- ViGene Biosciences lentiviral particle packaged cDNA for MGAT5 gene
- ViGene Biosciences ready-to-package AAV shRNAs for MGAT5 gene
- Search ViGene Biosciences for MGAT5
- Santa Cruz Biotechnology (SCBT) Antibodies for MGAT5
- Search Santa Cruz Biotechnology (SCBT) for MGAT5 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for MGAT5
- Horizon Cell Lines for MGAT5
- genomics-online: cdna clones - Search results for 89 available MGAT5 gene related products
- Overview of 89 available MGAT5 gene related products
- orf clones - Search results for 89 available MGAT5 gene related products
- Overview of 89 available MGAT5 gene related products
- genomics-online: gRNA clones - Search results for 89 available MGAT5 gene related products
- Overview of 89 available MGAT5 gene related products
- genomics-online: primer clones - Search results for 89 available MGAT5 gene related products
- Overview of 89 available MGAT5 gene related products
- genomics-online: shRNA clones - Search results for 89 available MGAT5 gene related products
- Overview of 89 available MGAT5 gene related products
Sources for MGAT5 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew