Free for academic non-profit institutions. Other users need a Commercial license
The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterati... See more...
Aliases for MGAT5 Gene
Aliases for MGAT5 Gene
- Alpha-1,6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase 2 3 5
- Alpha-1,6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase A 2 3 4
- GNT-V 2 3 4
- Mannosyl (Alpha-1,6-)-Glycoprotein Beta-1,6-N-Acetyl-Glucosaminyltransferase 2 3
- Alpha-Mannoside Beta-1,6-N-Acetylglucosaminyltransferase V 3 4
- Mannoside Acetylglucosaminyltransferase 5 3 4
External Ids for MGAT5 Gene
- HGNC: 7049
- NCBI Entrez Gene: 4249
- Ensembl: ENSG00000152127
- OMIM®: 601774
- UniProtKB/Swiss-Prot: Q09328
Previous GeneCards Identifiers for MGAT5 Gene
- GC02P132654
- GC02P133296
- GC02P135031
- GC02P135219
- GC02P134842
- GC02P134725
- GC02P134594
- GC02P127004
Summaries for MGAT5 Gene
-
The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the activity of this enzyme has been correlated with the progression of invasive malignancies. [provided by RefSeq, Oct 2011]
GeneCards Summary for MGAT5 Gene
MGAT5 (Alpha-1,6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase) is a Protein Coding gene. Diseases associated with MGAT5 include Hepatocellular Carcinoma and Colorectal Cancer. Among its related pathways are N-Glycan biosynthesis and Metabolism of proteins. Gene Ontology (GO) annotations related to this gene include acetylglucosaminyltransferase activity and alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity. An important paralog of this gene is MGAT5B.
UniProtKB/Swiss-Prot Summary for MGAT5 Gene
-
Catalyzes the addition of N-acetylglucosamine (GlcNAc) in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides (PubMed:10395745, PubMed:30140003). Catalyzes an important step in the biosynthesis of branched, complex-type N-glycans, such as those found on EGFR, TGFR (TGF-beta receptor) and CDH2 (PubMed:10395745, PubMed:22614033, PubMed:30140003). Via its role in the biosynthesis of complex N-glycans, plays an important role in the activation of cellular signaling pathways, reorganization of the actin cytoskeleton, cell-cell adhesion and cell migration. MGAT5-dependent EGFR N-glycosylation enhances the interaction between EGFR and LGALS3 and thereby prevents rapid EGFR endocytosis and prolongs EGFR signaling. Required for efficient interaction between TGFB1 and its receptor. Enhances activation of intracellular signaling pathways by several types of growth factors, including FGF2, PDGF, IGF, TGFB1 and EGF. MGAT5-dependent CDH2 N-glycosylation inhibits CDH2-mediated homotypic cell-cell adhesion and contributes to the regulation of downstream signaling pathways. Promotes cell migration. Contributes to the regulation of the inflammatory response. MGAT5-dependent TCR N-glycosylation enhances the interaction between TCR and LGALS3, limits agonist-induced TCR clustering, and thereby dampens TCR-mediated responses to antigens. Required for normal leukocyte evasation and accumulation at sites of inflammation (By similarity). Inhibits attachment of monocytes to the vascular endothelium and subsequent monocyte diapedesis (PubMed:22614033).
-
[Secreted alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A]: Promotes proliferation of umbilical vein endothelial cells and angiogenesis, at least in part by promoting the release of the growth factor FGF2 from the extracellular matrix.
Additional gene information for MGAT5 Gene
No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for MGAT5 Gene
Genomics for MGAT5 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for MGAT5 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around MGAT5 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for MGAT5
- Top Transcription factor binding sites by QIAGEN in the MGAT5 gene promoter:
-
- AML1a
- AP-1
- c-Fos
- c-Jun
- MIF-1
- POU2F1
- POU2F1a
Genomic Locations for MGAT5 Gene
Latest Assembly
- chr2:134,119,922-134,454,621
- (GRCh38/hg38)
- Size:
- 334,700 bases
- Orientation:
- Plus strand
Previous Assembly
- chr2:134,877,506-135,212,192
- (GRCh37/hg19 by Entrez Gene)
- Size:
- 334,687 bases
- Orientation:
- Plus strand
Genomic View for MGAT5 Gene
Genes around MGAT5 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 2q21.2-q21.3 by HGNC
- 2q21.2-q21.3 by Entrez Gene
- 2q21.2 by Ensembl
MGAT5 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for MGAT5 Gene
Proteins for MGAT5 Gene
-
Protein details for MGAT5 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q09328-MGT5A_HUMAN
- Recommended name:
- Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
- Protein Accession:
- Q09328
- D3DP70
Protein attributes for MGAT5 Gene
- Size:
- 741 amino acids
- Molecular mass:
- 84543 Da
- Quaternary structure:
- No Data Available
Protein Expression for MGAT5 Gene
Selected DME Specific Peptides for MGAT5 Gene
- Q09328:
-
- KDILVPSF
- NSTNSTTAVPSLV
- CSFFIYLSEVENWCP
- QEKCVLPPMDGYPHCEGKIKWMKDMWRSDPCYADYGVDG
- LVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYL
Post-translational modifications for MGAT5 Gene
- N-glycosylated.
- A secreted form is released from the membrane after cleavage by gamma-secretase.
-
Glycosylation at Asn110, Asn115, Asn118, Asn334, Asn433, and Asn447
- NX_Q09328 (NX_Q09328-1)
- Modification sites at PhosphoSitePlus
Other Protein References for MGAT5 Gene
Antibodies for research
- LifeSpan BioSciences GNT-V / MGAT5 Antibody
- Novus Biologicals Antibodies for MGAT5
-
Abcam antibodies for MGAT5
- Invitrogen Antibodies for MGAT5 (AFLGC-MGAT5)
-
Boster Bio Antibodies for MGAT5
-
Custom Antibody ServicesProSci Antibodies for MGAT5
-
Santa Cruz Biotechnology (SCBT) Antibodies for MGAT5
Protein products for research
- Search Origene for Purified Proteins, MassSpec and Protein Over-expression Lysates for MGAT5
- Origene Custom Protein Services for MGAT5
- Novus Biologicals proteins for MGAT5
- Sino Biological Recombinant Proteins for MGAT5
- Sino Biological Cell Lysates for MGAT5
- antibodies-online: Show 6 available MGAT5 Proteins ranked by validation data
- Compare Top MGAT5 Proteins
-
Quality Products:
-
Abcam proteins for MGAT5
Assay products for research
Domains & Families for MGAT5 Gene
Gene Families for MGAT5 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted membrane proteins
Protein Domains for MGAT5 Gene
- InterPro:
Suggested Antigen Peptide Sequences for MGAT5 Gene
- GenScript: Design optimal peptide antigens:
-
- N-acetylglucosaminyl-transferase V (MGT5A_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q09328- Family:
-
- Belongs to the glycosyltransferase 18 family.
Function for MGAT5 Gene
Molecular function for MGAT5 Gene
- UniProtKB/Swiss-Prot Function:
- Catalyzes the addition of N-acetylglucosamine (GlcNAc) in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides (PubMed:10395745, PubMed:30140003). Catalyzes an important step in the biosynthesis of branched, complex-type N-glycans, such as those found on EGFR, TGFR (TGF-beta receptor) and CDH2 (PubMed:10395745, PubMed:22614033, PubMed:30140003). Via its role in the biosynthesis of complex N-glycans, plays an important role in the activation of cellular signaling pathways, reorganization of the actin cytoskeleton, cell-cell adhesion and cell migration. MGAT5-dependent EGFR N-glycosylation enhances the interaction between EGFR and LGALS3 and thereby prevents rapid EGFR endocytosis and prolongs EGFR signaling. Required for efficient interaction between TGFB1 and its receptor. Enhances activation of intracellular signaling pathways by several types of growth factors, including FGF2, PDGF, IGF, TGFB1 and EGF. MGAT5-dependent CDH2 N-glycosylation inhibits CDH2-mediated homotypic cell-cell adhesion and contributes to the regulation of downstream signaling pathways. Promotes cell migration. Contributes to the regulation of the inflammatory response. MGAT5-dependent TCR N-glycosylation enhances the interaction between TCR and LGALS3, limits agonist-induced TCR clustering, and thereby dampens TCR-mediated responses to antigens. Required for normal leukocyte evasation and accumulation at sites of inflammation (By similarity). Inhibits attachment of monocytes to the vascular endothelium and subsequent monocyte diapedesis (PubMed:22614033).
- UniProtKB/Swiss-Prot Function:
- [Secreted alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A]: Promotes proliferation of umbilical vein endothelial cells and angiogenesis, at least in part by promoting the release of the growth factor FGF2 from the extracellular matrix.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=N(4)-{beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAcl-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N(4)-{beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAcl-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP; Xref=Rhea:RHEA:16921, Rhea:RHEA-COMP:14374, Rhea:RHEA-COMP:14377, ChEBI:CHEBI:15378, ChEBI:CHEBI:57705, ChEBI:CHEBI:58223, ChEBI:CHEBI:139507, ChEBI:CHEBI:139510; EC=2.4.1.155; Evidence={ECO:0000269|PubMed:10395745, ECO:0000269|PubMed:17142794, ECO:0000269|PubMed:30140003};.
- UniProtKB/Swiss-Prot Induction:
- Induced by IFNG treatment in monocytes (in vitro).
- UniProtKB/Swiss-Prot BiophysicochemicalProperties:
- Kinetic parameters: KM=6.78 mM for GlcNAc {ECO:0000269|PubMed:30140003}; KM=5.8 mM for GlcNAc {ECO:0000269|PubMed:10395745}; pH dependence: Optimum pH is 6.5. {ECO:0000269|PubMed:10395745}; Temperature dependence: Optimum temperature is 50 degrees Celsius. {ECO:0000269|PubMed:10395745};
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Activity is increased by Mn(2+) and Mg(2+).
- GENATLAS Biochemistry:
- mannosyl (alpha-1,6-) glycoprotein beta-1,6-N-acetylglucosaminyltransferase,Golgi,biosynthesis of complex Asn-linked (N) glycans
Enzyme Numbers (IUBMB) for MGAT5 Gene
Phenotypes From GWAS Catalog for MGAT5 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004864 | protein phosphatase inhibitor activity | IDA | 24846175 |
| GO:0008375 | acetylglucosaminyltransferase activity | IEA | -- |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0016757 | transferase activity, transferring glycosyl groups | IEA | -- |
| GO:0030144 | alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity | TAS | -- |
Phenotypes for MGAT5 Gene
- MGI mutant phenotypes for MGAT5:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for MGAT5:
Animal Models for MGAT5 Gene
- MGI Knock Outs for MGAT5:
-
- Mgat5 Mgat5<tm1Jwd>
Animal Models for research
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for MGAT5 - Starting at $85 >
- * MGAT5 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for MGAT5
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for MGAT5
-
Santa Cruz Biotechnology (SCBT) CRISPR for MGAT5
miRNA for MGAT5 Gene
- miRTarBase miRNAs that target MGAT5
-
- hsa-miR-502-3p (MIRT037984)
- hsa-miR-769-5p (MIRT039157)
- hsa-miR-181a-5p (MIRT047339)
- hsa-miR-23c (MIRT485405)
- hsa-miR-23b-3p (MIRT485406)
- hsa-miR-23a-3p (MIRT485407)
- hsa-miR-130a-5p (MIRT485408)
- hsa-miR-7847-3p (MIRT485409)
- hsa-miR-6894-5p (MIRT485410)
- hsa-miR-765 (MIRT485411)
- hsa-miR-7154-3p (MIRT485412)
- hsa-miR-766-5p (MIRT485413)
- hsa-miR-5189-3p (MIRT485414)
- hsa-miR-6511b-3p (MIRT541793)
- hsa-miR-6511a-3p (MIRT541794)
- hsa-miR-3680-5p (MIRT541795)
- hsa-miR-603 (MIRT541796)
- hsa-miR-8485 (MIRT541797)
- hsa-miR-7850-5p (MIRT623249)
- hsa-miR-4529-3p (MIRT623250)
- hsa-miR-4520-2-3p (MIRT623251)
- hsa-miR-8058 (MIRT623252)
- hsa-miR-5009-5p (MIRT623253)
- hsa-miR-1269b (MIRT623254)
- hsa-miR-1269a (MIRT623255)
- hsa-miR-3121-5p (MIRT623256)
- hsa-miR-4279 (MIRT656209)
- hsa-miR-6881-3p (MIRT656210)
- hsa-miR-5581-3p (MIRT656211)
- hsa-miR-1236-3p (MIRT656212)
- hsa-miR-6845-3p (MIRT656213)
- hsa-miR-3667-3p (MIRT656214)
- hsa-miR-877-3p (MIRT656215)
- hsa-miR-5685 (MIRT656216)
- hsa-miR-6872-3p (MIRT656217)
- hsa-miR-4690-3p (MIRT656218)
- hsa-miR-6743-5p (MIRT656219)
- hsa-miR-4688 (MIRT656220)
- hsa-miR-6768-5p (MIRT656221)
- hsa-miR-5681a (MIRT656222)
- hsa-miR-6891-3p (MIRT656223)
- hsa-miR-6072 (MIRT656224)
- hsa-miR-6738-3p (MIRT667404)
- hsa-miR-5001-3p (MIRT667405)
- hsa-miR-6886-3p (MIRT667406)
- hsa-miR-938 (MIRT667407)
- hsa-miR-6505-3p (MIRT667408)
- hsa-miR-324-3p (MIRT667409)
- hsa-miR-1913 (MIRT667410)
- hsa-miR-539-3p (MIRT687560)
- hsa-miR-485-3p (MIRT687561)
- hsa-miR-3941 (MIRT687562)
- hsa-miR-362-3p (MIRT687563)
- hsa-miR-329-3p (MIRT687564)
- hsa-miR-629-3p (MIRT712401)
- hsa-miR-29b-2-5p (MIRT712402)
- hsa-miR-6855-5p (MIRT712403)
- hsa-miR-3170 (MIRT712404)
- hsa-miR-519e-5p (MIRT712405)
- hsa-miR-515-5p (MIRT712406)
- hsa-miR-6742-5p (MIRT712407)
- hsa-miR-92a-2-5p (MIRT712408)
- hsa-miR-6766-5p (MIRT712409)
- hsa-miR-6756-5p (MIRT712410)
- hsa-miR-193b-5p (MIRT712411)
- hsa-miR-3925-3p (MIRT712412)
- hsa-miR-766-3p (MIRT712413)
- hsa-miR-665 (MIRT712414)
- hsa-miR-4459 (MIRT712415)
- hsa-miR-4695-5p (MIRT712416)
- hsa-miR-3155a (MIRT784690)
- hsa-miR-3155b (MIRT784693)
- hsa-miR-4438 (MIRT785879)
- hsa-miR-484 (MIRT786871)
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for MGAT5
- Browse OriGene Inhibitory RNA Products For MGAT5
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MGAT5
Clone products for research
- Applied Biological Materials (abm): Clones for MGAT5 - Starting at $45 >
- * MGAT5 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for MGAT5
- Addgene plasmids for MGAT5
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for MGAT5
Cell Lines for research
-
Horizon Cell Lines for MGAT5
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MGAT5 Gene
Localization for MGAT5 Gene
Subcellular locations from UniProtKB/Swiss-Prot for MGAT5 Gene
- Golgi apparatus membrane. Single-pass type II membrane protein.
- [Secreted alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A]: Secreted.
| Compartment | Confidence |
|---|---|
| golgi apparatus | 5 |
| extracellular | 4 |
| endoplasmic reticulum | 3 |
| plasma membrane | 2 |
| cytoskeleton | 1 |
| mitochondrion | 1 |
| peroxisome | 1 |
| nucleus | 1 |
| endosome | 1 |
| cytosol | 1 |
| lysosome | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000139 | Golgi membrane | TAS | -- |
| GO:0005576 | extracellular region | IEA | -- |
| GO:0005794 | Golgi apparatus | IBA | 21873635 |
| GO:0016020 | membrane | IEA,IDA | 10395745 |
| GO:0016021 | integral component of membrane | IEA | -- |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for MGAT5 Gene
Pathways & Interactions for MGAT5 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Transport to the Golgi and subsequent modification | ||
| 2 | Metabolism of proteins | ||
| 3 | N-glycan antennae elongation in the medial/trans-Golgi | ||
| 4 | Metabolism | ||
| 5 | N-Glycan biosynthesis | ||
Pathways by source for MGAT5 Gene
2 KEGG pathways for MGAT5 Gene
UniProtKB/Swiss-Prot Q09328-MGT5A_HUMAN
- Pathway: Protein modification; protein glycosylation.
Interacting Proteins for MGAT5 Gene
GPS-Prot Interaction Network for MGAT5
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006486 | protein glycosylation | IEA | -- |
| GO:0006487 | protein N-linked glycosylation | IDA | 24846175 |
| GO:0018215 | protein phosphopantetheinylation | IEA | -- |
| GO:0018279 | protein N-linked glycosylation via asparagine | IDA | 10395745 |
| GO:0030335 | positive regulation of cell migration | IDA | 24846175 |
No data available for SIGNOR curated interactions for MGAT5 Gene
Drugs & Compounds for MGAT5 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Uridine 5'-diphosphate | Experimental | Pharma | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| Uridine diphosphate-N-acetylglucosamine |
|
528-04-1 |
|
Transcripts for MGAT5 Gene
mRNA/cDNA for MGAT5 Gene
- 2 REFSEQ mRNAs :
- 10 NCBI additional mRNA sequence :
- 5 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000281923 8332 nts (view in UCSC)
- ENST00000409645 8252 nts (view in UCSC)
- ENST00000468758 816 nts (view in UCSC)
- ENST00000481801 651 nts (view in UCSC)
- ENST00000488365 365 nts (view in UCSC)
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for MGAT5 - Starting at $85 >
- * MGAT5 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for MGAT5
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for MGAT5
-
Santa Cruz Biotechnology (SCBT) CRISPR for MGAT5
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for MGAT5
- Browse OriGene Inhibitory RNA Products For MGAT5
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MGAT5
Clone products for research
- Applied Biological Materials (abm): Clones for MGAT5 - Starting at $45 >
- * MGAT5 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for MGAT5
- Addgene plasmids for MGAT5
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for MGAT5
Relevant External Links for MGAT5 Gene
- GeneLoc Exon Structure for
- MGAT5
Expression for MGAT5 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Brain (Nervous System)
- Neural Tube (Nervous System)
-
Blood (Hematopoietic System)
- Natural Killer Cells Peripheral Blood
- Kidney (Urinary System)
This gene is overexpressed in Testis (13.2), Heart (11.5), Placenta (11.1), Vitreous humor (10.8), and Urine (8.3).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for MGAT5 Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for MGAT5
SOURCE GeneReport for Unigene cluster for MGAT5 Gene:
Hs.4988Evidence on tissue expression from TISSUES for MGAT5 Gene
- Liver(4.3)
- Nervous system(4)
- Intestine(3.5)
- Lymph node(2.3)
- Skin(2.3)
- Heart(2.3)
- Spleen(2.3)
- Kidney(2.2)
- Muscle(2.1)
- Blood(2)
Primer products for research
-
OriGene qPCR primer pairs for MGAT5
Gene Expression Assays for research
No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for MGAT5 Gene
Orthologs for MGAT5 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | MGAT5 29 30 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | MGAT5 29 30 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | MGAT5 30 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | MGAT5 29 30 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Mgat5 29 16 30 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Mgat5 29 |
|
||
| Platypus (Ornithorhynchus anatinus) |
Mammalia | MGAT5 30 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | MGAT5 29 30 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | MGAT5 30 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | mgat5 29 |
|
||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.1926 29 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | mgat5 29 30 |
|
OneToOne | |
| Dr.12083 29 |
|
||||
| Worm (Caenorhabditis elegans) |
Secernentea | gly-2 29 30 |
|
OneToMany | |
| Sea Squirt (Ciona savignyi) |
Ascidiacea | -- 30 |
|
OneToOne |
- Species where no ortholog for MGAT5 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Fruit Fly (Drosophila melanogaster)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for MGAT5 Gene
- ENSEMBL:
- Gene Tree for MGAT5 (if available)
- TreeFam:
- Gene Tree for MGAT5 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for MGAT5: view image
- Alliance of Genome Resources:
- Additional Orthologs for MGAT5
Paralogs for MGAT5 Gene
Variants for MGAT5 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for MGAT5 Gene
| SNP ID | Clinical significance and condition | Chr 02 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs139534721 | Likely Benign: not provided | 134,403,077(+) |
C/T NM_002410.5(MGAT5):c.1470C>T (p.Tyr490=) |
SYNONYMOUS |
All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv667n67 | CNV | loss | 20364138 |
| esv3368288 | CNV | insertion | 20981092 |
| esv3592553 | CNV | loss | 21293372 |
| nsv1004271 | CNV | loss | 25217958 |
| nsv1004843 | CNV | gain | 25217958 |
| nsv1008965 | CNV | loss | 25217958 |
| nsv1009691 | CNV | gain | 25217958 |
| nsv1142286 | CNV | tandem duplication | 24896259 |
| nsv478303 | CNV | novel sequence insertion | 20440878 |
| nsv508107 | OTHER | sequence alteration | 20534489 |
| nsv834385 | CNV | gain | 17160897 |
Residual Variation Intolerance Score:
11.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.38;
27.26% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for MGAT5 Gene
SNP Genotyping and Copy Number Assays for research
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MGAT5 Gene
Disorders for MGAT5 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| hepatocellular carcinoma |
|
|
| colorectal cancer |
|
|
| walker-warburg syndrome |
|
|
Search MGAT5 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for MGAT5
- Human Genome Epidemiology Navigator
- (HuGE)
- Atlas
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for MGAT5 Gene
Publications for MGAT5 Gene
- cDNA cloning and chromosomal mapping of human N-acetylglucosaminyltransferase V+. (PMID: 8292036) Saito H … Taniguchi N (Biochemical and biophysical research communications 1994) 2 3 4 22
- A secreted type of beta 1,6-N-acetylglucosaminyltransferase V (GnT-V) induces tumor angiogenesis without mediation of glycosylation: a novel function of GnT-V distinct from the original glycosyltransferase activity. (PMID: 11872751) Saito T … Taniguchi N (The Journal of biological chemistry 2002) 3 4 22
- Structure and mechanism of cancer-associated N-acetylglucosaminyltransferase-V. (PMID: 30140003) Nagae M … Yamaguchi Y (Nature communications 2018) 3 4
- N-acetylglucosaminyltransferase V negatively regulates integrin α5β1-mediated monocyte adhesion and transmigration through vascular endothelium. (PMID: 22614033) Yang HM … Yang Z (International journal of oncology 2012) 3 4
- MGAT5 and disease severity in progressive multiple sclerosis. (PMID: 21115203) Esposito F … Martinelli Boneschi F (Journal of neuroimmunology 2011) 3 40
ExternalLinks
Products for MGAT5 Gene
- View all 2 R&D Systems MGAT5 (N-Acetylglucosaminyltransferase V/MGAT5) Products
- View all R&D Systems MGAT5 (N-Acetylglucosaminyltransferase V/MGAT5) Proteins and Enzymes
- View all R&D Systems MGAT5 (N-Acetylglucosaminyltransferase V/MGAT5) Primary Antibodies
- Learn more about R&D Systems custom MGAT5 antibody, protein, and immunoassay development services
- Browse OriGene Antibodies
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for Purified Proteins, MassSpec and Protein Over-expression Lysates for MGAT5
- Origene Custom Protein Services for MGAT5
- Origene shrna, sirna, and RNAi products in human, mouse, rat for MGAT5
- Browse OriGene Inhibitory RNA Products For MGAT5
- OriGene qPCR primer pairs for MGAT5
- OriGene CRISPR knockouts for MGAT5
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For MGAT5
- Sino Biological Human cDNA Clone for MGAT5
- Sino Biological Recombinant Proteins for MGAT5
- Sino Biological Cell Lysates for MGAT5
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Recombinant Proteins
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for MGAT5
- Novus Biologicals proteins for MGAT5
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for MGAT5
- Abcam proteins for MGAT5
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Invitrogen Antibodies for MGAT5 (AFLGC-MGAT5)
- VectorBuilder Custom and pre-made DNA vectors for MGAT5 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for MGAT5 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for MGAT5 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for MGAT5 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for MGAT5
- Addgene plasmids for MGAT5
- antibodies-online: Show 11 available MGAT5 Antibodies ranked by validation data
- Compare Top MGAT5 Antibodies
- antibodies-online: Show 16 available MGAT5 Elisa Kits ranked by validation data
- Compare Top MGAT5 Elisa Kits
- antibodies-online: Show 6 available MGAT5 Proteins ranked by validation data
- Compare Top MGAT5 Proteins
- Quality Products:
- Santa Cruz Biotechnology (SCBT) Antibodies for MGAT5
- Search Santa Cruz Biotechnology (SCBT) for MGAT5 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for MGAT5
- Horizon Cell Lines for MGAT5
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for MGAT5
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for MGAT5
- Search GeneCopoeia for miRNA 3'UTR Target clone products for MGAT5
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MGAT5
- Boster Bio Antibodies for MGAT5
- Browse Boster Bio ELISA Kits
Sources for MGAT5 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM® (Updated: 05-Apr-2021)
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) ASD
- (27) SAGE
- (28) SOURCE
- (29) HomoloGene
- (30) PanEnsembl
- (31) euGenes
- (32) SGD
- (33) FlyBase
- (34) WormBase
- (35) Pseudogene
- (36) DGV
- (37) dbSNP
- (38) GenAtlas
- (39) HGMD
- (40) GAD
- (41) BGMUT
- (42) HuGE
- (43) Atlas
- (44) GenBank
- (45) HORDE
- (46) HUGE
- (47) IMGT
- (48) Leiden
- (49) miRBase
- (50) DME
- (51) OriGene
- (52) PubMed
- (53) R&D Systems
- (54) Tocris
- (55) Abcam
- (56) Novus Biologicals
- (57) ProSpec
- (58) Sino Biological
- (59) GenScript
- (60) Qiagen
- (61) OCA
- (62) Proteopedia
- (63) MOPED
- (64) neXtProt
- (65) Reactome
- (66) GeneGo (Thomson Reuters)
- (67) DISEASES
- (68) SIMAP
- (69) GenomeRNAi
- (70) LifeMap
- (71) miRTarBase
- (72) MalaCards
- (73) Invitrogen
- (74) BitterDB
- (75) ESI-BIO
- (76) RefSeq
- (77) BioSystems
- (78) MaxQB
- (79) IUPHAR
- (80) BioGPS
- (81) Illumina
- (82) COMPARTMENTS
- (83) HOMER
- (84) PaxDb
- (85) ApexBio
- (86) Addgene
- (87) antibodies-online
- (88) CYP
- (89) NONCODE
- (90) TreeFam
- (91) PathCards
- (92) GeneReviews
- (93) GeneTex
- (94) Taconic Biosciences
- (95) GTEx
- (96) ProteomicsDB
- (97) SCBT
- (98) DGIdb
- (99) ClinicalTrials
- (100) RVIS
- (101) SIGNOR
- (102) diseasecard
- (103) NIH Rare Diseases
- (104) Orphanet
- (105) UMLS
- (106) GTR
- (107) Disease Ontology
- (108) MedlinePlus Genetics
- (109) MeSH
- (110) MedlinePlus
- (111) CDC
- (112) NINDS
- (113) NCBI Bookshelf
- (114) ClinVar
- (115) Gene Damage Index
- (116) HPO
- (117) UDN
- (118) VISTA
- (119) FANTOM5
- (120) ENCODE
- (121) ProSci
- (122) Horizon
- (123) The Signaling Pathways Project (SPP)
- (124) IID
- (125) VectorBuilder
- (126) SNPedia
- (127) BRCA Exchange
- (128) CIViC
- (129) ProteoGenix
- (130) dbSUPER
- (131) TISSUES
- (132) Gene ORGANizer
- (133) abm
- (134) Human Protein Atlas
- (135) GWAS Catalog
- (136) Monarch Initiative
- (137) DataMed
- (138) HumanCyc
- (139) UCNEbase
- (140) EPDnew
- (141) Applied Biosystems
- (142) GlyConnect
- (143) Aminode
- (144) GeneCopoeia
- (145) GPS-Prot
- (146) RNAcentral
- (147) LncRNADisease
- (148) LOVD
- (149) miR2Disease
- (150) DiseaseEnhancer
- (151) Boster Bio
- (152) Biorbyt
- (153) Biocompare
- (154) Mastermind
- (155) CTD^2 Dashboard
- (156) CraniofacialAtlas
- (157) GeneImprint
- (158) Synthego
- (159) ENA
- (160) GtRNAdb
- (161) LncBase
- (162) LncBook
- (163) LNCipedia
- (164) Modomics
- (165) PDBe
- (166) Rfam
- (167) SILVA
- (168) snOPY
- (169) SRPDB
- (170) GENCODE
- (171) TarBase
- (172) Open Targets Platform
- (173) 5SRRNADB
- (174) snoDB
- (175) MirGeneDB
- (176) Alliance of Genome Resources