Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MAST2 Gene

Aliases for MAST2 Gene

  • Microtubule Associated Serine/Threonine Kinase 2 2 3 5
  • EC 2.7.11.1 4 56
  • MAST205 3 4
  • Microtubule Associated Testis Specific Serine/Threonine Protein Kinase 3
  • Microtubule-Associated Serine/Threonine-Protein Kinase 2 3
  • EC 2.7.11 56
  • KIAA0807 4
  • MTSSK 3

External Ids for MAST2 Gene

Previous GeneCards Identifiers for MAST2 Gene

  • GC01P045639
  • GC01P045981
  • GC01P046041
  • GC01P046252
  • GC01P044384

Summaries for MAST2 Gene

GeneCards Summary for MAST2 Gene

MAST2 (Microtubule Associated Serine/Threonine Kinase 2) is a Protein Coding gene. Diseases associated with MAST2 include Breast Mucinous Carcinoma. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is MAST4.

UniProtKB/Swiss-Prot for MAST2 Gene

  • Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins. Functions in a multi-protein complex in spermatid maturation. Regulates lipopolysaccharide-induced IL-12 synthesis in macrophages by forming a complex with TRAF6, resulting in the inhibition of TRAF6 NF-kappa-B activation (By similarity).

Gene Wiki entry for MAST2 Gene

Additional gene information for MAST2 Gene

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MAST2 Gene

Genomics for MAST2 Gene

GeneHancer (GH) Regulatory Elements for MAST2 Gene

Promoters and enhancers for MAST2 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH01I045801 Promoter/Enhancer 2.3 EPDnew FANTOM5 Ensembl ENCODE 577.1 +16.8 16777 3.6 HDGF CLOCK ARNT ARID4B SIN3A FEZF1 ZNF2 SLC30A9 ZNF766 ZNF213 MAST2 GPBP1L1 CCDC163 EFCAB14-AS1 RPL7AP16 TOE1 LRRC41 MOB3C IPP CCDC17
GH01I045785 Enhancer 0.5 Ensembl 550.8 -1.3 -1286 0.2 SRF IKZF1 MAX ZFP36 EBF1 MYC GABPA MAST2 RPL6P1
GH01I046129 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 26.5 +346.0 345966 6.3 CLOCK MLX ZFP64 FEZF1 DMAP1 IRF4 YY1 SLC30A9 ZNF213 E2F8 PIK3R3 LOC101929626 TOE1 GPBP1L1 LRRC41 RPL7AP16 EFCAB14-AS1 RPS15AP10 MOB3C TMEM69
GH01I045749 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE 23.9 -35.7 -35733 3.1 HDGF PKNOX1 CLOCK FOXA2 ARNT ARID4B SIN3A DMAP1 ZNF2 IRF4 IPP LOC105378693 LRRC41 TOE1 GPBP1L1 HECTD3 CCDC163 RPL7AP16 MUTYH MAST2
GH01I045684 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 23.6 -100.0 -100017 5.1 CLOCK ZFP64 FEZF1 DMAP1 IRF4 YY1 SLC30A9 ZNF213 E2F8 ZNF143 GPBP1L1 TMEM69 LRRC41 TOE1 RPS8 RPL7AP16 EFCAB14-AS1 HECTD3 MAST2 RPS15AP10
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around MAST2 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the MAST2 gene promoter:

Genomic Locations for MAST2 Gene

Genomic Locations for MAST2 Gene
chr1:45,786,987-46,036,124
(GRCh38/hg38)
Size:
249,138 bases
Orientation:
Plus strand
chr1:46,252,659-46,501,796
(GRCh37/hg19)

Genomic View for MAST2 Gene

Genes around MAST2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MAST2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MAST2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MAST2 Gene

Proteins for MAST2 Gene

  • Protein details for MAST2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q6P0Q8-MAST2_HUMAN
    Recommended name:
    Microtubule-associated serine/threonine-protein kinase 2
    Protein Accession:
    Q6P0Q8
    Secondary Accessions:
    • O94899
    • Q5VT07
    • Q5VT08
    • Q7LGC4
    • Q8NDG1
    • Q96B94
    • Q9BYE8

    Protein attributes for MAST2 Gene

    Size:
    1798 amino acids
    Molecular mass:
    196436 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Interacts with CDHR2.
    SequenceCaution:
    • Sequence=AAH15816.2; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=AAH15816.2; Type=Frameshift; Positions=1114, 1387; Evidence={ECO:0000305}; Sequence=BAB40778.1; Type=Frameshift; Positions=1688; Evidence={ECO:0000305}; Sequence=CAH73245.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAI16563.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAI21706.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for MAST2 Gene

    Alternative splice isoforms for MAST2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for MAST2 Gene

Selected DME Specific Peptides for MAST2 Gene

Q6P0Q8:
  • MMNHVYKERFPKATAQMEE
  • SYKAKMARR
  • AETVLALEYLH
  • LYEFLVGCVPFFGDTPEELFGQV
  • RPRSRSL
  • CGTPEYIAPE
  • KRSSLFRKITKQ
  • RSLSPGR
  • GKPVDWWA
  • RPARLLECLEF
  • PRSPLLKRVQS
  • EVVELILKSGNKVA
  • GHIKLTDFGLSK
  • IKLTDFG
  • KVIKSASATALS
  • WPEGDEALP
  • LLHTSRSLSSLNRSLSS
  • GIVHRDLKPDN
  • KVYSSME
  • FVERDILTFAENPFVV
  • LLEAAEGHAKEG
  • SPLASPMSP
  • RHLCMVMEYVEGGDCATLLKNIGALPV
  • LTDFGLSK
  • KLTDFGL
  • DGRRWSLASLPSSGYGTNTPSSTVSSSCSSQE
  • LSFIHHQ
  • LPRPHSPL
  • GHIKLTD
  • LDWTGLLRQKAEFIP
  • KELSLPRRG
  • SPQRSPSPL
  • NLEKLLQDA
  • ARDCLDKS
  • VHRDLKP
  • IVHRDLK

Post-translational modifications for MAST2 Gene

  • Phosphorylated and ubiquitinated. N-terminal ubiquitination leads to degradation of MAST2 by proteasome-mediated proteolysis. N-terminal phosphorylation appears to be a prerequisite for ubiquitination (By similarity).

Domains & Families for MAST2 Gene

Gene Families for MAST2 Gene

Suggested Antigen Peptide Sequences for MAST2 Gene

Graphical View of Domain Structure for InterPro Entry

Q6P0Q8

UniProtKB/Swiss-Prot:

MAST2_HUMAN :
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Family:
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
genes like me logo Genes that share domains with MAST2: view

Function for MAST2 Gene

Molecular function for MAST2 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins. Functions in a multi-protein complex in spermatid maturation. Regulates lipopolysaccharide-induced IL-12 synthesis in macrophages by forming a complex with TRAF6, resulting in the inhibition of TRAF6 NF-kappa-B activation (By similarity).

Enzyme Numbers (IUBMB) for MAST2 Gene

Phenotypes From GWAS Catalog for MAST2 Gene

Gene Ontology (GO) - Molecular Function for MAST2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding IEA,ISS --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA,IBA --
GO:0005515 protein binding IPI 12117771
GO:0005524 ATP binding IEA,ISS --
genes like me logo Genes that share ontologies with MAST2: view
genes like me logo Genes that share phenotypes with MAST2: view

Animal Models for MAST2 Gene

MGI Knock Outs for MAST2:

Animal Model Products

miRNA for MAST2 Gene

miRTarBase miRNAs that target MAST2

Clone Products

  • Addgene plasmids for MAST2

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MAST2 Gene

Localization for MAST2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MAST2 Gene

Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note=Recruited to the sub-membranous area on interaction with CDHR2.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MAST2 gene
Compartment Confidence
plasma membrane 4
cytoskeleton 4
cytosol 4
nucleus 2
peroxisome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for MAST2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005856 cytoskeleton IEA --
GO:0005886 plasma membrane IEA --
GO:0015630 microtubule cytoskeleton IBA --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with MAST2: view

Pathways & Interactions for MAST2 Gene

SuperPathways for MAST2 Gene

No Data Available

SIGNOR curated interactions for MAST2 Gene

Activates:

Gene Ontology (GO) - Biological Process for MAST2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA,ISS --
GO:0007010 cytoskeleton organization IBA --
GO:0016310 phosphorylation IEA --
GO:0018105 peptidyl-serine phosphorylation IBA --
GO:0035556 intracellular signal transduction IBA --
genes like me logo Genes that share ontologies with MAST2: view

No data available for Pathways by source for MAST2 Gene

Drugs & Compounds for MAST2 Gene

(2) Drugs for MAST2 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Magnesium Approved Nutra 0
ATP Investigational Nutra Agonist 0

(1) Additional Compounds for MAST2 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with MAST2: view

Transcripts for MAST2 Gene

Unigene Clusters for MAST2 Gene

Microtubule associated serine/threonine kinase 2:
Representative Sequences:

Clone Products

  • Addgene plasmids for MAST2

Alternative Splicing Database (ASD) splice patterns (SP) for MAST2 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4a · 4b ^ 5 ^ 6a · 6b · 6c ^ 7 ^ 8a · 8b ^ 9 ^ 10 ^ 11a · 11b ^ 12 ^ 13 ^ 14 ^ 15a · 15b ^ 16 ^ 17a · 17b ^ 18 ^ 19 ^
SP1: - - - - - -
SP2: - - -
SP3: -
SP4: -
SP5:
SP6:

ExUns: 20 ^ 21 ^ 22 ^ 23 ^ 24 ^ 25 ^ 26a · 26b
SP1: -
SP2:
SP3:
SP4:
SP5:
SP6:

Relevant External Links for MAST2 Gene

GeneLoc Exon Structure for
MAST2
ECgene alternative splicing isoforms for
MAST2

Expression for MAST2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for MAST2 Gene

mRNA differential expression in normal tissues according to GTEx for MAST2 Gene

This gene is overexpressed in Muscle - Skeletal (x6.3).

Protein differential expression in normal tissues from HIPED for MAST2 Gene

This gene is overexpressed in Spleen (35.4) and Liver, secretome (16.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MAST2 Gene



NURSA nuclear receptor signaling pathways regulating expression of MAST2 Gene:

MAST2

SOURCE GeneReport for Unigene cluster for MAST2 Gene:

Hs.319481

mRNA Expression by UniProt/SwissProt for MAST2 Gene:

Q6P0Q8-MAST2_HUMAN
Tissue specificity: Abundant in the testis.

Evidence on tissue expression from TISSUES for MAST2 Gene

  • Liver(4.2)
  • Muscle(2.5)
  • Nervous system(2.2)
genes like me logo Genes that share expression patterns with MAST2: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAST2 Gene

Orthologs for MAST2 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for MAST2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MAST2 33 34
  • 99.54 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia MAST2 34
  • 93 (a)
OneToOne
dog
(Canis familiaris)
Mammalia MAST2 33 34
  • 89.14 (n)
cow
(Bos Taurus)
Mammalia MAST2 33 34
  • 88.41 (n)
rat
(Rattus norvegicus)
Mammalia Mast2 33
  • 86.7 (n)
mouse
(Mus musculus)
Mammalia Mast2 33 16 34
  • 86.09 (n)
oppossum
(Monodelphis domestica)
Mammalia -- 34
  • 84 (a)
OneToMany
-- 34
  • 62 (a)
OneToMany
chicken
(Gallus gallus)
Aves MAST2 33 34
  • 73.66 (n)
lizard
(Anolis carolinensis)
Reptilia MAST2 34
  • 81 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia mast2 33
  • 71.39 (n)
zebrafish
(Danio rerio)
Actinopterygii mast2 33 34
  • 71.35 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG6498 34
  • 33 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea kin-4 34
  • 32 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes KIN82 34
  • 27 (a)
ManyToMany
FPK1 34
  • 25 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 44 (a)
OneToMany
Species where no ortholog for MAST2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for MAST2 Gene

ENSEMBL:
Gene Tree for MAST2 (if available)
TreeFam:
Gene Tree for MAST2 (if available)

Paralogs for MAST2 Gene

Paralogs for MAST2 Gene

genes like me logo Genes that share paralogs with MAST2: view

Variants for MAST2 Gene

Sequence variations from dbSNP and Humsavar for MAST2 Gene

SNP ID Clin Chr 01 pos Variation AA Info Type
VAR_040772 An ovarian mucinous carcinoma sample p.Lys275Glu
VAR_040774 A breast mucinous carcinoma sample p.Gly655Ala
rs1000004040 -- 45,816,029(+) A/G genic_upstream_transcript_variant, intron_variant
rs1000011026 -- 45,968,529(+) C/T intron_variant
rs1000019784 -- 45,833,112(+) A/G genic_upstream_transcript_variant, intron_variant

Structural Variations from Database of Genomic Variants (DGV) for MAST2 Gene

Variant ID Type Subtype PubMed ID
esv2761743 CNV gain 21179565
esv2663245 CNV deletion 23128226
esv2662133 CNV deletion 23128226
esv2583928 CNV deletion 19546169
esv1778390 CNV deletion 17803354
esv1000231 CNV deletion 20482838
dgv79n106 CNV deletion 24896259
dgv31e212 CNV gain 25503493
dgv257n54 CNV gain 21841781
dgv19e214 CNV gain 21293372
dgv159n100 CNV gain 25217958
nsv958628 CNV deletion 24416366
nsv945924 CNV duplication 23825009
nsv829737 CNV gain 17160897
nsv546161 CNV gain 21841781
nsv546158 CNV gain 21841781
nsv524147 CNV gain 19592680
nsv522438 CNV loss 19592680
nsv515934 CNV loss 19592680
nsv472806 CNV novel sequence insertion 20440878
nsv461417 CNV gain 19166990
nsv437479 CNV loss 16327808
nsv1150942 CNV duplication 26484159
nsv1146241 CNV deletion 26484159
nsv1119685 CNV deletion 24896259
nsv1077814 CNV deletion 25765185
nsv1014128 CNV gain 25217958
nsv10139 CNV gain 18304495
nsv1013729 CNV gain 25217958
nsv1013628 CNV gain 25217958
nsv1009527 CNV gain 25217958
nsv1007750 CNV gain 25217958
nsv1003554 CNV gain 25217958
esv9144 CNV loss 19470904
esv5205 CNV loss 18987735
esv3893512 CNV gain 25118596
esv3585926 CNV loss 21293372
esv3585925 CNV gain 21293372
esv3585924 CNV loss 21293372
esv3585921 CNV gain 21293372
esv3585918 CNV loss 21293372
esv3585915 CNV gain 21293372
esv3585914 CNV gain 21293372
esv3577805 CNV gain 25503493
esv3577360 CNV gain 25503493
esv3561604 CNV deletion 23714750
esv3448249 CNV insertion 20981092
esv3368524 CNV insertion 20981092
esv3307196 CNV mobile element insertion 20981092

Variation tolerance for MAST2 Gene

Residual Variation Intolerance Score: 24.6% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 15.45; 97.15% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for MAST2 Gene

Human Gene Mutation Database (HGMD)
MAST2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
MAST2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAST2 Gene

Disorders for MAST2 Gene

MalaCards: The human disease database

(1) MalaCards diseases for MAST2 Gene - From: HGMD and GeneCards

Disorder Aliases PubMed IDs
breast mucinous carcinoma
  • invasive mucinous breast carcinoma
- elite association - COSMIC cancer census association via MalaCards
Search MAST2 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for MAST2

genes like me logo Genes that share disorders with MAST2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for MAST2 Gene

Publications for MAST2 Gene

  1. The DNA sequence and biological annotation of human chromosome 1. (PMID: 16710414) Gregory SG … Prigmore E (Nature 2006) 3 4 58
  2. Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. (PMID: 17081983) Olsen JV … Mann M (Cell 2006) 3 4 58
  3. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
  4. Interaction of TRAF6 with MAST205 regulates NF-kappaB activation and MAST205 stability. (PMID: 15308666) Xiong H … Unkeless JC (The Journal of biological chemistry 2004) 3 22 58
  5. Protocadherin LKC, a new candidate for a tumor suppressor of colon and liver cancers, its association with contact inhibition of cell proliferation. (PMID: 12117771) Okazaki N … Koga H (Carcinogenesis 2002) 3 4 58

Products for MAST2 Gene

  • Addgene plasmids for MAST2

Sources for MAST2 Gene

Content
Loading form....