Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MARCH5 Gene

Aliases for MARCH5 Gene

  • Membrane Associated Ring-CH-Type Finger 5 2 3 5
  • Mitochondrial Ubiquitin Ligase 2 3 4
  • Membrane-Associated Ring Finger (C3HC4) 5 2 3
  • Membrane-Associated RING Finger Protein 5 3 4
  • RING-Type E3 Ubiquitin Transferase MARCH5 3 4
  • Membrane-Associated RING-CH Protein V 3 4
  • Ring Finger Protein 153 2 3
  • MARCH-V 3 4
  • RNF153 3 4
  • MITOL 3 4
  • E3 Ubiquitin-Protein Ligase MARCH5 3
  • Membrane Associated Ring Finger 5 3
  • RING Finger Protein 153 4
  • EC 2.3.2.27 4
  • EC 6.3.2 56

External Ids for MARCH5 Gene

Previous HGNC Symbols for MARCH5 Gene

  • RNF153

Previous GeneCards Identifiers for MARCH5 Gene

  • GC10P094041
  • GC10P087679

Summaries for MARCH5 Gene

Entrez Gene Summary for MARCH5 Gene

  • MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]).[supplied by OMIM, Mar 2008]

GeneCards Summary for MARCH5 Gene

MARCH5 (Membrane Associated Ring-CH-Type Finger 5) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include ligase activity and GTPase binding.

UniProtKB/Swiss-Prot for MARCH5 Gene

  • Mitochondrial E3 ubiquitin-protein ligase that plays a crucial role in the control of mitochondrial morphology by acting as a positive regulator of mitochondrial fission. May play a role in the prevention of cell senescence acting as a regulator of mitochondrial quality control. Promotes ubiquitination of FIS1, DNM1L and MFN1.

Gene Wiki entry for MARCH5 Gene

Additional gene information for MARCH5 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MARCH5 Gene

Genomics for MARCH5 Gene

GeneHancer (GH) Regulatory Elements for MARCH5 Gene

Promoters and enhancers for MARCH5 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH10I092289 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 550.8 +0.5 476 3.3 HDGF PKNOX1 FOXA2 MLX ARID4B SIN3A DMAP1 ZNF2 YY1 ZNF213 CPEB3 MARCH5 NHP2P1 BTAF1 GC10P092304 GC10M092263
GH10I092238 Promoter/Enhancer 2 EPDnew FANTOM5 Ensembl ENCODE 12.1 -51.2 -51157 4 PKNOX1 FOXA2 SMAD1 ARID4B SIN3A FEZF1 DMAP1 YY1 POLR2B ZNF766 CPEB3 MARCH5 BTAF1 NHP2P1 ENSG00000199881
GH10I092087 Enhancer 1.1 Ensembl ENCODE 11.9 -203.3 -203262 0.6 ARID4B SIN3A ZNF2 ARID2 ZNF143 ZNF548 RUNX3 DEK RXRA REST BTAF1 MARCH5 CPEB3 ENSG00000252993 SDHCP2
GH10I092100 Enhancer 1.1 Ensembl ENCODE 11.5 -189.4 -189431 1.7 HDGF PKNOX1 SMAD1 FEZF1 IRF4 ZNF207 FOS ATF7 RUNX3 RXRA CPEB3 MARCH5 ENSG00000252993 SDHCP2
GH10I092114 Enhancer 0.8 ENCODE 10.7 -176.8 -176754 0.2 ELF3 FOXA2 MLX RARA YY1 CREM THAP11 MIXL1 RXRA REST CPEB3 ENSG00000252993 MARCH5 NHP2P1 SDHCP2
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around MARCH5 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the MARCH5 gene promoter:

Genomic Locations for MARCH5 Gene

Genomic Locations for MARCH5 Gene
chr10:92,291,163-92,353,964
(GRCh38/hg38)
Size:
62,802 bases
Orientation:
Plus strand
chr10:94,050,920-94,113,721
(GRCh37/hg19)

Genomic View for MARCH5 Gene

Genes around MARCH5 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MARCH5 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MARCH5 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MARCH5 Gene

Proteins for MARCH5 Gene

  • Protein details for MARCH5 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9NX47-MARH5_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase MARCH5
    Protein Accession:
    Q9NX47

    Protein attributes for MARCH5 Gene

    Size:
    278 amino acids
    Molecular mass:
    31232 Da
    Quaternary structure:
    • Monomer and homodimer. Interacts with MFN1, MFN2, DNM1L and FIS1.
    Miscellaneous:
    • By binding to and ubiquitinating two ALS1 variants of SOD1 (mSOD1 variants Arg-86 and Ala-94) it attenuates their cytotoxicity.

neXtProt entry for MARCH5 Gene

Selected DME Specific Peptides for MARCH5 Gene

Q9NX47:
  • KVYFKQQQYL
  • GLDVMERADPLFLL
  • SNLQRTILGGIAFV
  • LGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYG
  • CWVCFAT
  • AVTYGAVTVMQVVGHK
  • PAEANPLADHVSATRILCGALVFPTIATIVGKLMFS
  • LGKMIRWEDYV

Post-translational modifications for MARCH5 Gene

Other Protein References for MARCH5 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for MARCH5 Gene

Gene Families for MARCH5 Gene

Protein Domains for MARCH5 Gene

Graphical View of Domain Structure for InterPro Entry

Q9NX47

UniProtKB/Swiss-Prot:

MARH5_HUMAN :
  • The RING-CH-type zinc finger domain is required for E3 ligase activity.
Domain:
  • The RING-CH-type zinc finger domain is required for E3 ligase activity.
genes like me logo Genes that share domains with MARCH5: view

No data available for Suggested Antigen Peptide Sequences for MARCH5 Gene

Function for MARCH5 Gene

Molecular function for MARCH5 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.
UniProtKB/Swiss-Prot Function:
Mitochondrial E3 ubiquitin-protein ligase that plays a crucial role in the control of mitochondrial morphology by acting as a positive regulator of mitochondrial fission. May play a role in the prevention of cell senescence acting as a regulator of mitochondrial quality control. Promotes ubiquitination of FIS1, DNM1L and MFN1.

Enzyme Numbers (IUBMB) for MARCH5 Gene

Phenotypes From GWAS Catalog for MARCH5 Gene

Gene Ontology (GO) - Molecular Function for MARCH5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004842 ubiquitin-protein transferase activity IMP 16874301
GO:0005515 protein binding IPI 16874301
GO:0008270 zinc ion binding IEA --
GO:0016740 transferase activity IEA --
GO:0046872 metal ion binding IEA --
genes like me logo Genes that share ontologies with MARCH5: view
genes like me logo Genes that share phenotypes with MARCH5: view

Animal Models for MARCH5 Gene

MGI Knock Outs for MARCH5:

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MARCH5 Gene

Localization for MARCH5 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MARCH5 Gene

Mitochondrion outer membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=Authors show that the protein can be detected in endoplasmic reticulum (PubMed:14722266). Authors (PubMed:16874301) show its presence only in mitochondria (PubMed:16874301). {ECO:0000269 PubMed:14722266, ECO:0000269 PubMed:16874301}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MARCH5 gene
Compartment Confidence
mitochondrion 5
endoplasmic reticulum 5
plasma membrane 3
peroxisome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for MARCH5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005739 mitochondrion IEA,IDA --
GO:0005741 mitochondrial outer membrane IDA,IEA 16874301
GO:0005783 endoplasmic reticulum IEA,IDA 14722266
GO:0005789 endoplasmic reticulum membrane IEA,IDA 14722266
GO:0016020 membrane HDA,IEA 19946888
genes like me logo Genes that share ontologies with MARCH5: view

Pathways & Interactions for MARCH5 Gene

SuperPathways for MARCH5 Gene

No Data Available

UniProtKB/Swiss-Prot Q9NX47-MARH5_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for MARCH5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000209 protein polyubiquitination IDA 16936636
GO:0016567 protein ubiquitination IEA --
GO:0051865 protein autoubiquitination IDA 16874301
GO:0070585 protein localization to mitochondrion IMP 17606867
GO:0090140 regulation of mitochondrial fission IMP 16874301
genes like me logo Genes that share ontologies with MARCH5: view

No data available for Pathways by source and SIGNOR curated interactions for MARCH5 Gene

Drugs & Compounds for MARCH5 Gene

(3) Drugs for MARCH5 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved, Investigational Nutra 0
ATP Investigational Nutra Agonist 0

(1) Additional Compounds for MARCH5 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8
genes like me logo Genes that share compounds with MARCH5: view

Transcripts for MARCH5 Gene

Unigene Clusters for MARCH5 Gene

Membrane-associated ring finger (C3HC4) 5:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for MARCH5 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3 ^ 4a · 4b ^ 5 ^ 6 ^ 7a · 7b ^ 8 ^ 9
SP1: - - - -
SP2: -
SP3: - - -
SP4: - -
SP5: - - -
SP6: - - - - -
SP7: - - -

Relevant External Links for MARCH5 Gene

GeneLoc Exon Structure for
MARCH5
ECgene alternative splicing isoforms for
MARCH5

Expression for MARCH5 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for MARCH5 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for MARCH5 Gene

This gene is overexpressed in Nasal epithelium (54.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MARCH5 Gene



Protein tissue co-expression partners for MARCH5 Gene

SOURCE GeneReport for Unigene cluster for MARCH5 Gene:

Hs.573490

mRNA Expression by UniProt/SwissProt for MARCH5 Gene:

Q9NX47-MARH5_HUMAN
Tissue specificity: Expressed in brain, heart, liver, lung, spleen, stomach, testis, skeletal and muscle.

Evidence on tissue expression from TISSUES for MARCH5 Gene

  • Liver(4.2)
  • Nervous system(4)
genes like me logo Genes that share expression patterns with MARCH5: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for MARCH5 Gene

Orthologs for MARCH5 Gene

This gene was present in the common ancestor of animals.

Orthologs for MARCH5 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MARCH5 33 34
  • 100 (n)
oppossum
(Monodelphis domestica)
Mammalia MARCH5 34
  • 100 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia MARCH5 34
  • 99 (a)
OneToOne
cow
(Bos Taurus)
Mammalia MARCH5 33 34
  • 95.2 (n)
dog
(Canis familiaris)
Mammalia MARCH5 33 34
  • 95.08 (n)
rat
(Rattus norvegicus)
Mammalia March5 33
  • 93.05 (n)
mouse
(Mus musculus)
Mammalia March5 33 16 34
  • 92.81 (n)
chicken
(Gallus gallus)
Aves MARCH5 33 34
  • 87.23 (n)
lizard
(Anolis carolinensis)
Reptilia MARCH5 34
  • 97 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia march5 33
  • 79.12 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.19345 33
zebrafish
(Danio rerio)
Actinopterygii march5 33 34
  • 76.8 (n)
-- 33
fruit fly
(Drosophila melanogaster)
Insecta CG9855 33 34
  • 55.64 (n)
CG17991 34
  • 36 (a)
OneToMany
CG10761 34
  • 32 (a)
OneToMany
CG16781 34
  • 32 (a)
OneToMany
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP001041 33
  • 53.26 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 52 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.6753 33
Species where no ortholog for MARCH5 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for MARCH5 Gene

ENSEMBL:
Gene Tree for MARCH5 (if available)
TreeFam:
Gene Tree for MARCH5 (if available)

Paralogs for MARCH5 Gene

No data available for Paralogs for MARCH5 Gene

Variants for MARCH5 Gene

Sequence variations from dbSNP and Humsavar for MARCH5 Gene

SNP ID Clin Chr 10 pos Variation AA Info Type
rs1000000952 -- 92,324,529(+) TTTTTTT/TTTTTTTT intron_variant
rs1000035340 -- 92,339,243(+) G/A intron_variant
rs1000115527 -- 92,317,106(+) TTATTATTATTATT/TTATTATTATT intron_variant
rs1000117911 -- 92,325,002(+) A/C intron_variant
rs1000141835 -- 92,332,071(+) T/G intron_variant

Structural Variations from Database of Genomic Variants (DGV) for MARCH5 Gene

Variant ID Type Subtype PubMed ID
nsv1046258 CNV gain 25217958
esv3624220 CNV gain 21293372
esv3624219 CNV loss 21293372
esv2670111 CNV deletion 23128226

Variation tolerance for MARCH5 Gene

Residual Variation Intolerance Score: 40.3% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for MARCH5 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
MARCH5

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MARCH5 Gene

Disorders for MARCH5 Gene

Additional Disease Information for MARCH5

No disorders were found for MARCH5 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for MARCH5 Gene

Publications for MARCH5 Gene

  1. Downregulation of major histocompatibility complex class I by human ubiquitin ligases related to viral immune evasion proteins. (PMID: 14722266) Bartee E … Früh K (Journal of virology 2004) 2 3 4 58
  2. Loss of MARCH5 mitochondrial E3 ubiquitin ligase induces cellular senescence through dynamin-related protein 1 and mitofusin 1. (PMID: 20103533) Park YY … Cho H (Journal of cell science 2010) 3 4 58
  3. Mitochondrial ubiquitin ligase MITOL ubiquitinates mutant SOD1 and attenuates mutant SOD1-induced reactive oxygen species generation. (PMID: 19741096) Yonashiro R … Yanagi S (Molecular biology of the cell 2009) 3 4 58
  4. The mitochondrial E3 ubiquitin ligase MARCH5 is required for Drp1 dependent mitochondrial division. (PMID: 17606867) Karbowski M … Youle RJ (The Journal of cell biology 2007) 3 4 58
  5. MARCH-V is a novel mitofusin 2- and Drp1-binding protein able to change mitochondrial morphology. (PMID: 16936636) Nakamura N … Hirose S (EMBO reports 2006) 3 4 58

Products for MARCH5 Gene

Sources for MARCH5 Gene

Content
Loading form....