Free for academic non-profit institutions. Other users need a Commercial license
The protein encoded by this gene is a member of the Ser/Thr protein kinase family, and is most closely related to mitogen-activated protein kinases (MAP kinases). MAP kinases also known as extracellular signal-regulated kinases (ERKs), are activated through protein phosphorylation cascades and act as integration points for multiple biochemical signals. This kinase is localized ... See more...
Aliases for MAPK6 Gene
Aliases for MAPK6 Gene
External Ids for MAPK6 Gene
- HGNC: 6879
- NCBI Entrez Gene: 5597
- Ensembl: ENSG00000069956
- OMIM®: 602904
- UniProtKB/Swiss-Prot: Q16659
Previous HGNC Symbols for MAPK6 Gene
- PRKM6
Previous GeneCards Identifiers for MAPK6 Gene
- GC15P047869
- GC15P045358
- GC15P049890
- GC15P050027
- GC15P050098
- GC15P052311
- GC15P029169
Summaries for MAPK6 Gene
-
The protein encoded by this gene is a member of the Ser/Thr protein kinase family, and is most closely related to mitogen-activated protein kinases (MAP kinases). MAP kinases also known as extracellular signal-regulated kinases (ERKs), are activated through protein phosphorylation cascades and act as integration points for multiple biochemical signals. This kinase is localized in the nucleus, and has been reported to be activated in fibroblasts upon treatment with serum or phorbol esters. [provided by RefSeq, Jul 2008]
GeneCards Summary for MAPK6 Gene
MAPK6 (Mitogen-Activated Protein Kinase 6) is a Protein Coding gene. Diseases associated with MAPK6 include Pulmonary Immaturity and Aromatase Excess Syndrome. Among its related pathways are G-Beta Gamma Signaling and Non-Canonical Wnt Pathway. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is MAPK4.
UniProtKB/Swiss-Prot Summary for MAPK6 Gene
-
Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6. May promote entry in the cell cycle (By similarity).
Additional gene information for MAPK6 Gene
No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for MAPK6 Gene
Genomics for MAPK6 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for MAPK6 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around MAPK6 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for MAPK6
- Top Transcription factor binding sites by QIAGEN in the MAPK6 gene promoter:
-
- ARP-1
- CREB
- Egr-3
- ER-alpha
- NF-AT
- NF-AT1
- NF-AT2
- NF-AT3
- NF-AT4
- Sox9
Genomic Locations for MAPK6 Gene
Latest Assembly
- chr15:51,952,106-52,067,375
- (GRCh38/hg38)
- Size:
- 115,270 bases
- Orientation:
- Plus strand
Previous Assembly
- chr15:52,311,416-52,359,572
- (GRCh37/hg19 by Entrez Gene)
- Size:
- 48,157 bases
- Orientation:
- Plus strand
Genomic View for MAPK6 Gene
Genes around MAPK6 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 15q21.2 by HGNC
- 15q21.2 by Entrez Gene
- 15q21.2 by Ensembl
MAPK6 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for MAPK6 Gene
Proteins for MAPK6 Gene
-
Protein details for MAPK6 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q16659-MK06_HUMAN
- Recommended name:
- Mitogen-activated protein kinase 6
- Protein Accession:
- Q16659
- B2R945
- B5BU65
- Q68DH4
- Q8IYN8
Protein attributes for MAPK6 Gene
- Size:
- 721 amino acids
- Molecular mass:
- 82681 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Quaternary structure:
-
- Heterodimer with ERK4/MAPK4. Interacts with (via FRIEDE motif) MAPKAPK5 (By similarity). Interacts with UBE3A; this interaction may be indirect and mediated by HERC2, possibly via HERC2 interaction with NEURL4.
Protein Expression for MAPK6 Gene
Selected DME Specific Peptides for MAPK6 Gene
- Q16659:
-
- DPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDT
- GLKYIHSA
- HSHIYNWERYH
- GCIFAEM
- LSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCI
- YIVQEYMETDLA
- LFAGAHELEQMQLIL
- HSANVLHRDL
- LKYIHSA
- QLLRGLKY
- RVAIKKI
- VLHRDLK
- NGLVKAQIALEEASQQL
- TEDLVLKIGDFGLARI
- KHALREIKIIRRLDHDNIVKV
- LKIGDFG
- VDKLNDLNSSVSQ
- PMDRLTAE
Post-translational modifications for MAPK6 Gene
- Phosphorylated at Ser-189 by PAK1, PAK2 and PAK3 resulting in catalytic activation. Phosphorylated by MAPKAPK5 at other sites.
- Ubiquitination at Met-1 leads to degradation by the proteasome pathway.
-
Ubiquitination at Lys4, Lys447, Lys471, Lys480, Lys517, Lys563, Lys631, Lys672, Lys691, and Lys703
- NX_Q16659 (NX_Q16659-1)
- Modification sites at PhosphoSitePlus
Other Protein References for MAPK6 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibodies for research
- LifeSpan BioSciences MAPK6 / ERK3 Antibody (LS-B9961) and MAPK6 / ERK3 Antibody (LS-B10395)
- NSJ Bioreagents MAPK6 Antibody
-
Custom Antibody ServicesOriGene Antibodies for MAPK6
- Novus Biologicals Antibodies for MAPK6
- Invitrogen Antibodies for MAPK6 (AFLGC-MAPK6)
- antibodies-online: Show 47 available MAPK6 Antibodies ranked by validation data
- Compare Top MAPK6 Antibodies
-
Recommended
- 111 WB Antibodies (anti-human)
- 12 IF (p) Antibodies (anti-human)
- 4 IHC Antibodies (anti-human)
- 2 IHC (p) Antibodies (anti-human)
- 2 IP Antibodies (anti-human)
- 1 FACS Antibody (anti-human)
- 62 WB Antibodies (anti-rat)
- 12 IF (p) Antibodies (anti-rat)
- 2 IHC Antibodies (anti-rat)
- 81 WB Antibodies (anti-mouse)
- 12 IF (p) Antibodies (anti-mouse)
- 3 IHC Antibodies (anti-mouse)
-
Boster Bio Antibodies for MAPK6
-
Santa Cruz Biotechnology (SCBT) Antibodies for MAPK6
- Sino Biological Antibodies for MAPK6
Protein products for research
-
OriGene Purified Proteins for MAPK6
- Search Origene for MassSpec and Protein Over-expression Lysates for MAPK6
- Origene Custom Protein Services for MAPK6
-
Abcam proteins for MAPK6
Assay products for research
- Novus Biologicals ELISA Kits for MAPK6
- antibodies-online: Show 14 available MAPK6 Elisa Kits ranked by validation data
- Compare Top MAPK6 Elisa Kits
-
Quality Products:
Domains & Families for MAPK6 Gene
Gene Families for MAPK6 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for MAPK6 Gene
- InterPro:
- Blocks:
-
- ERK3/4 MAP kinase signature
Suggested Antigen Peptide Sequences for MAPK6 Gene
- GenScript: Design optimal peptide antigens:
-
- Mitogen-activated protein kinase 6 (B5BU65_HUMAN)
- MAP kinase isoform p97 (MK06_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q16659UniProtKB/Swiss-Prot:
MK06_HUMAN :- In contrast to classical MAPKs, the TXY motif within the activation loop is replaced by the SEG motif, whose phosphorylation activates the MAP kinases.
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
- Domain:
-
- In contrast to classical MAPKs, the TXY motif within the activation loop is replaced by the SEG motif, whose phosphorylation activates the MAP kinases.
- Family:
-
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Function for MAPK6 Gene
Molecular function for MAPK6 Gene
- UniProtKB/Swiss-Prot Function:
- Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6. May promote entry in the cell cycle (By similarity).
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.24;.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.24;.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Activated by phosphorylation at Ser-189.
Enzyme Numbers (IUBMB) for MAPK6 Gene
Phenotypes From GWAS Catalog for MAPK6 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0004672 | protein kinase activity | IEA | -- |
| GO:0004674 | protein serine/threonine kinase activity | TAS | -- |
| GO:0004707 | MAP kinase activity | IEA,ISS | -- |
| GO:0005515 | protein binding | IPI | 20936779 |
Phenotypes for MAPK6 Gene
- MGI mutant phenotypes for MAPK6:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for MAPK6:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 25%
- no effect
- Decreased viability
- Resistant to vaccinia virus (VACV-A4L) infection
- Decreased hepcidin::fluc mRNA expression
- Decreased epidermal growth factor (EGF) endocytosis, decreased transferrin (TF) endocytosis
- Decreased substrate adherent cell growth
- Increased viability
- Negative genetic interaction between KRASG13D/+ and KRAS+/-
- Increased cell migration
- Increased mitotic index
- Increased cell viability after pRB stimulation
Animal Models for MAPK6 Gene
- MGI Knock Outs for MAPK6:
-
- Mapk6 Mapk6<tm1Melo>
Animal Models for research
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for MAPK6 - Starting at $85 >
- * MAPK6 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for MAPK6
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for MAPK6
-
Santa Cruz Biotechnology (SCBT) CRISPR for MAPK6
miRNA for MAPK6 Gene
- miRTarBase miRNAs that target MAPK6
-
- mmu-miR-541-5p (MIRT008135)
- mmu-miR-324-3p (MIRT010729)
- hsa-miR-128-3p (MIRT021894)
- hsa-miR-100-5p (MIRT048392)
- hsa-miR-99a-5p (MIRT048608)
- hsa-miR-15a-5p (MIRT051334)
- hsa-miR-577 (MIRT193058)
- hsa-miR-26a-5p (MIRT193070)
- hsa-miR-26b-5p (MIRT193071)
- hsa-miR-1297 (MIRT193073)
- hsa-miR-3662 (MIRT193075)
- hsa-miR-4465 (MIRT193076)
- hsa-miR-511-3p (MIRT193093)
- hsa-miR-3177-5p (MIRT193094)
- hsa-let-7a-5p (MIRT193097)
- hsa-let-7b-5p (MIRT193098)
- hsa-let-7c-5p (MIRT193099)
- hsa-let-7d-5p (MIRT193100)
- hsa-let-7e-5p (MIRT193101)
- hsa-let-7f-5p (MIRT193102)
- hsa-miR-98-5p (MIRT193103)
- hsa-let-7g-5p (MIRT193104)
- hsa-let-7i-5p (MIRT193105)
- hsa-miR-3935 (MIRT193110)
- hsa-miR-4458 (MIRT193112)
- hsa-miR-4500 (MIRT193113)
- hsa-miR-4643 (MIRT193114)
- hsa-miR-10a-3p (MIRT281381)
- hsa-miR-363-5p (MIRT281386)
- hsa-miR-1293 (MIRT281393)
- hsa-miR-3115 (MIRT281394)
- hsa-miR-4307 (MIRT281397)
- hsa-miR-4483 (MIRT281400)
- hsa-miR-6745 (MIRT281402)
- hsa-miR-6756-5p (MIRT281403)
- hsa-miR-6766-5p (MIRT281404)
- hsa-miR-4304 (MIRT385976)
- hsa-miR-302a-5p (MIRT448682)
- hsa-miR-3920 (MIRT448683)
- hsa-miR-29a-5p (MIRT448684)
- hsa-miR-5697 (MIRT448685)
- hsa-miR-4776-3p (MIRT501968)
- hsa-miR-4715-3p (MIRT501969)
- hsa-miR-3064-3p (MIRT501970)
- hsa-miR-19b-2-5p (MIRT501971)
- hsa-miR-19b-1-5p (MIRT501972)
- hsa-miR-19a-5p (MIRT501973)
- hsa-miR-2052 (MIRT501974)
- hsa-miR-190a-3p (MIRT542883)
- hsa-miR-8076 (MIRT542884)
- hsa-miR-5011-5p (MIRT542885)
- hsa-miR-8485 (MIRT542886)
- hsa-miR-664b-3p (MIRT556260)
- hsa-miR-579-3p (MIRT556261)
- hsa-miR-5696 (MIRT556262)
- hsa-miR-4724-3p (MIRT556263)
- hsa-miR-202-3p (MIRT556264)
- hsa-miR-153-5p (MIRT556265)
- hsa-miR-1250-3p (MIRT556266)
- hsa-miR-664a-3p (MIRT556267)
- hsa-miR-6813-3p (MIRT556268)
- hsa-miR-3200-3p (MIRT556269)
- hsa-miR-4789-5p (MIRT611992)
- hsa-miR-3941 (MIRT611993)
- hsa-miR-603 (MIRT611994)
- hsa-miR-362-3p (MIRT611995)
- hsa-miR-329-3p (MIRT611996)
- hsa-miR-6787-3p (MIRT656449)
- hsa-miR-3942-3p (MIRT656450)
- hsa-miR-499b-5p (MIRT656451)
- hsa-miR-4494 (MIRT656452)
- hsa-miR-8087 (MIRT656453)
- hsa-miR-7161-5p (MIRT656454)
- hsa-miR-548u (MIRT656455)
- hsa-miR-1277-5p (MIRT708054)
- hsa-miR-1252-3p (MIRT708055)
- hsa-miR-3646 (MIRT708056)
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for MAPK6
- Browse OriGene Inhibitory RNA Products For MAPK6
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MAPK6
Clone products for research
- Applied Biological Materials (abm): Clones for MAPK6 - Starting at $45 >
- * MAPK6 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for MAPK6
- Addgene plasmids for MAPK6
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for MAPK6
Cell Lines for research
-
Horizon Cell Lines for MAPK6
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MAPK6 Gene
Localization for MAPK6 Gene
Subcellular locations from UniProtKB/Swiss-Prot for MAPK6 Gene
- Cytoplasm. Nucleus. Note=Translocates to the cytoplasm following interaction with MAPKAPK5. {ECO:0000250}.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 5 |
| cytoskeleton | 3 |
| plasma membrane | 2 |
| extracellular | 2 |
| mitochondrion | 1 |
| peroxisome | 1 |
| endoplasmic reticulum | 1 |
| endosome | 1 |
| lysosome | 1 |
| golgi apparatus | 1 |
- Cytosol (3)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IBA,ISS | -- |
| GO:0005654 | nucleoplasm | TAS | -- |
| GO:0005737 | cytoplasm | IBA,ISS | -- |
| GO:0005829 | cytosol | TAS | -- |
| GO:0032156 | septin cytoskeleton | IDA | -- |
Pathways & Interactions for MAPK6 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | IL-2 Pathway |
ErbB Family Pathway
.59
ErbB4 Pathway
.59
Prolactin Signaling
.54
Thrombopoietin Pathway
.51
Growth Hormone Signaling
.49
|
ErbB2-ErbB3 Heterodimers
.49
IL-2 Pathway
.48
HMGB1 Pathway
.36
PI3K Signaling in B-Lymphocyte
.35
|
| 2 | GPCR Pathway |
Ras Pathway
.73
GPCR Pathway
.62
Pancreatic Adenocarcinoma
.59
|
Breast Cancer Regulation by Stathmin1
.58
NFAT in Immune Response
.58
|
| 3 | VEGF Signaling |
.38
|
|
| 4 | TNFR1 Pathway |
TNF Signaling
.55
|
.34
|
| 5 | Apoptotic Pathways in Synovial Fibroblasts |
Glioma Invasiveness
.64
eIF2 Pathway
.60
|
Rap1 Pathway
.57
|
Pathways by source for MAPK6 Gene
10 Sino Biological pathways for MAPK6 Gene
7 BioSystems pathways for MAPK6 Gene
3 Reactome pathways for MAPK6 Gene
1 PharmGKB pathway for MAPK6 Gene
1 KEGG pathway for MAPK6 Gene
2 Tocris pathways for MAPK6 Gene
55 Qiagen pathways for MAPK6 Gene
- 14-3-3 Induced Apoptosis
- 14-3-3 Induced Intracellular Signaling
- 4-1BB Pathway
- Aldosterone Signaling in Epithelial Cells
- Androgen Signaling
1 Cell Signaling Technology pathway for MAPK6 Gene
Interacting Proteins for MAPK6 Gene
Selected Interacting proteins:
Q16659-MK06_HUMAN
ENSP00000261845
for MAPK6 Gene via
UniProtKB
MINT
STRING
IID
GPS-Prot Interaction Network for MAPK6
SIGNOR curated interactions for MAPK6 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000165 | MAPK cascade | IEA | -- |
| GO:0006468 | protein phosphorylation | IEA,ISS | -- |
| GO:0007049 | cell cycle | IEA | -- |
| GO:0007165 | signal transduction | TAS | 2032290 |
| GO:0010468 | regulation of gene expression | IBA | -- |
Drugs & Compounds for MAPK6 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Aspirin | Approved, Vet_approved | Pharma | Target | 1600 | ||
| Minocycline | Approved, Investigational | Pharma | Target, inhibitor | 240 | ||
| Magnesium | Approved, Experimental, Investigational | Pharma | 0 | |||
| ATP | Investigational | Nutra | 0 | |||
| FR 180204 | Pharma | ERK inhibitor, Selective ERK inhibitor | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
58-64-0 |
|
(1) ApexBio Compounds for MAPK6 Gene
| Compound | Action | Cas Number |
|---|---|---|
| FR 180204 | ERK inhibitor | 865362-74-9 |
Transcripts for MAPK6 Gene
mRNA/cDNA for MAPK6 Gene
- 1 REFSEQ mRNAs :
- 8 NCBI additional mRNA sequence :
- 12 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000261845 5330 nts (view in UCSC)
- ENST00000558063 583 nts (view in UCSC)
- ENST00000558100 514 nts (view in UCSC)
- ENST00000558841 656 nts (view in UCSC)
- ENST00000558891 583 nts (view in UCSC)
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for MAPK6 - Starting at $85 >
- * MAPK6 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for MAPK6
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for MAPK6
-
Santa Cruz Biotechnology (SCBT) CRISPR for MAPK6
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for MAPK6
- Browse OriGene Inhibitory RNA Products For MAPK6
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MAPK6
Clone products for research
- Applied Biological Materials (abm): Clones for MAPK6 - Starting at $45 >
- * MAPK6 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for MAPK6
- Addgene plasmids for MAPK6
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for MAPK6
| ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5a | · | 5b | · | 5c | · | 5d | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | ||||||||||||||||||||
| SP2: | - | - | |||||||||||||||||||||
| SP3: | - | - | |||||||||||||||||||||
| SP4: | - |
Relevant External Links for MAPK6 Gene
- GeneLoc Exon Structure for
- MAPK6
Expression for MAPK6 Gene
This gene is overexpressed in Brain (37.6), Monocytes (18.1), and Heart (13.3).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for MAPK6 Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for MAPK6
SOURCE GeneReport for Unigene cluster for MAPK6 Gene:
Hs.411847mRNA Expression by UniProt/SwissProt for MAPK6 Gene:
Q16659-MK06_HUMAN
Tissue specificity:
Highest expression in the skeletal muscle, followed by the brain. Also found in heart, placenta, lung, liver, pancreas, kidney and skin fibroblasts.
Evidence on tissue expression from TISSUES for MAPK6 Gene
- Nervous system(4.5)
- Muscle(4.5)
- Liver(2.5)
- Kidney(2.4)
- Skin(2.3)
- Lung(2.2)
- Heart(2.2)
- Pancreas(2.2)
- Thyroid gland(2.1)
Primer products for research
-
OriGene qPCR primer pairs for MAPK6
-
OriGene qPCR primer pairs and template standards for MAPK6
Gene Expression Assays for research
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAPK6 Gene
Orthologs for MAPK6 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | MAPK6 29 30 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | MAPK6 29 30 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | -- 30 |
|
OneToMany | |
| -- 30 |
|
OneToMany | |||
| -- 30 |
|
OneToMany | |||
| Cow (Bos Taurus) |
Mammalia | MAPK6 29 30 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Mapk6 29 16 30 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Mapk6 29 |
|
||
| Platypus (Ornithorhynchus anatinus) |
Mammalia | MAPK6 30 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | MAPK6 29 30 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | MAPK6 30 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | mapk6 29 |
|
||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.23931 29 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | mapk6 29 30 |
|
OneToOne | |
| Baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | KSS1 30 |
|
ManyToMany | |
| FUS3 30 |
|
ManyToMany | |||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | CSA.7149 30 |
|
OneToMany |
- Species where no ortholog for MAPK6 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Fruit Fly (Drosophila melanogaster)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
- Worm (Caenorhabditis elegans)
Evolution for MAPK6 Gene
- ENSEMBL:
- Gene Tree for MAPK6 (if available)
- TreeFam:
- Gene Tree for MAPK6 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for MAPK6: view image
- Alliance of Genome Resources:
- Additional Orthologs for MAPK6
Paralogs for MAPK6 Gene
Paralogs for MAPK6 Gene
(9) SIMAP similar genes for MAPK6 Gene using alignment to 1 proteins:
- MK06_HUMAN
Pseudogenes.org Pseudogenes for MAPK6 Gene
Variants for MAPK6 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for MAPK6 Gene
| SNP ID | Clinical significance and condition | Chr 15 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs35697691 | -- |
p.Leu290Val |
All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv2595n100 | CNV | gain | 25217958 |
| dgv303e201 | CNV | deletion | 23290073 |
| esv2351837 | CNV | deletion | 18987734 |
| esv2749691 | CNV | deletion | 23290073 |
| nsv1039841 | CNV | gain | 25217958 |
| nsv1116073 | CNV | deletion | 24896259 |
| nsv1138369 | CNV | deletion | 24896259 |
| nsv1536 | CNV | deletion | 18451855 |
| nsv471244 | CNV | gain | 18288195 |
| nsv984070 | CNV | duplication | 23825009 |
| nsv984071 | CNV | duplication | 23825009 |
Residual Variation Intolerance Score:
9.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
3.72;
57.57% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for MAPK6 Gene
SNP Genotyping and Copy Number Assays for research
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAPK6 Gene
Disorders for MAPK6 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| pulmonary immaturity |
|
|
| aromatase excess syndrome |
|
|
Search MAPK6 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for MAPK6
- Atlas
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for MAPK6 Gene
Publications for MAPK6 Gene
- Primary structure, expression and chromosomal locus of a human homolog of rat ERK3. (PMID: 8875998) Meloche S … Pellerin J (Oncogene 1996) 2 3 4 22
- N-Terminal ubiquitination of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome. (PMID: 15226418) Coulombe P … Meloche S (Molecular and cellular biology 2004) 3 4 22
- Identification and proteomic analysis of distinct UBE3A/E6AP protein complexes. (PMID: 22645313) Martínez-Noël G … Howley PM (Molecular and cellular biology 2012) 3 4
- Regulation of ERK3/MAPK6 expression by BRAF. (PMID: 16964379) Hoeflich KP … Seshagiri S (International journal of oncology 2006) 3 22
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
ExternalLinks
Products for MAPK6 Gene
- Custom Antibody ServicesOriGene Antibodies for MAPK6
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for MAPK6
- Search Origene for MassSpec and Protein Over-expression Lysates for MAPK6
- Origene Custom Protein Services for MAPK6
- Origene shrna, sirna, and RNAi products in human, mouse, rat for MAPK6
- Browse OriGene Inhibitory RNA Products For MAPK6
- OriGene qPCR primer pairs for MAPK6
- OriGene qPCR primer pairs and template standards for MAPK6
- OriGene CRISPR knockouts for MAPK6
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For MAPK6
- Sino Biological Human cDNA Clone for MAPK6
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Sino Biological Antibodies for MAPK6
- Browse Sino Biological Assays
- Browse Antibodies
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for MAPK6
- Novus Biologicals proteins and lysates for MAPK6
- Novus Biologicals ELISA Kits for MAPK6
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam proteins for MAPK6
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Invitrogen Antibodies for MAPK6 (AFLGC-MAPK6)
- ApexBio compounds for MAPK6
- VectorBuilder Custom and pre-made DNA vectors for MAPK6 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for MAPK6 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for MAPK6 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for MAPK6 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for MAPK6
- Addgene plasmids for MAPK6
- antibodies-online: Show 47 available MAPK6 Antibodies ranked by validation data
- Compare Top MAPK6 Antibodies
- Recommended
- 111 WB Antibodies (anti-human)
- 12 IF (p) Antibodies (anti-human)
- 4 IHC Antibodies (anti-human)
- 2 IHC (p) Antibodies (anti-human)
- 2 IP Antibodies (anti-human)
- 1 FACS Antibody (anti-human)
- 62 WB Antibodies (anti-rat)
- 12 IF (p) Antibodies (anti-rat)
- 2 IHC Antibodies (anti-rat)
- 81 WB Antibodies (anti-mouse)
- 12 IF (p) Antibodies (anti-mouse)
- 3 IHC Antibodies (anti-mouse)
- antibodies-online: Show 14 available MAPK6 Elisa Kits ranked by validation data
- Compare Top MAPK6 Elisa Kits
- Quality Products:
- antibodies-online: Show 11 available MAPK6 Proteins ranked by validation data
- Compare Top MAPK6 Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for MAPK6
- Search Santa Cruz Biotechnology (SCBT) for MAPK6 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for MAPK6
- Horizon Cell Lines for MAPK6
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for MAPK6
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for MAPK6
- Search GeneCopoeia for miRNA 3'UTR Target clone products for MAPK6
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MAPK6
- Boster Bio Antibodies for MAPK6
Sources for MAPK6 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM® (Updated: 05-Apr-2021)
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) ASD
- (27) SAGE
- (28) SOURCE
- (29) HomoloGene
- (30) PanEnsembl
- (31) euGenes
- (32) SGD
- (33) FlyBase
- (34) WormBase
- (35) Pseudogene
- (36) DGV
- (37) dbSNP
- (38) GenAtlas
- (39) HGMD
- (40) GAD
- (41) BGMUT
- (42) HuGE
- (43) Atlas
- (44) GenBank
- (45) HORDE
- (46) HUGE
- (47) IMGT
- (48) Leiden
- (49) miRBase
- (50) DME
- (51) OriGene
- (52) PubMed
- (53) R&D Systems
- (54) Tocris
- (55) Abcam
- (56) Novus Biologicals
- (57) ProSpec
- (58) Sino Biological
- (59) GenScript
- (60) Qiagen
- (61) OCA
- (62) Proteopedia
- (63) MOPED
- (64) neXtProt
- (65) Reactome
- (66) GeneGo (Thomson Reuters)
- (67) DISEASES
- (68) SIMAP
- (69) GenomeRNAi
- (70) LifeMap
- (71) miRTarBase
- (72) MalaCards
- (73) Invitrogen
- (74) BitterDB
- (75) ESI-BIO
- (76) RefSeq
- (77) BioSystems
- (78) MaxQB
- (79) IUPHAR
- (80) BioGPS
- (81) Illumina
- (82) COMPARTMENTS
- (83) HOMER
- (84) PaxDb
- (85) ApexBio
- (86) Addgene
- (87) antibodies-online
- (88) CYP
- (89) NONCODE
- (90) TreeFam
- (91) PathCards
- (92) GeneReviews
- (93) GeneTex
- (94) Taconic Biosciences
- (95) GTEx
- (96) ProteomicsDB
- (97) SCBT
- (98) DGIdb
- (99) ClinicalTrials
- (100) RVIS
- (101) SIGNOR
- (102) diseasecard
- (103) NIH Rare Diseases
- (104) Orphanet
- (105) UMLS
- (106) GTR
- (107) Disease Ontology
- (108) MedlinePlus Genetics
- (109) MeSH
- (110) MedlinePlus
- (111) CDC
- (112) NINDS
- (113) NCBI Bookshelf
- (114) ClinVar
- (115) Gene Damage Index
- (116) HPO
- (117) UDN
- (118) VISTA
- (119) FANTOM5
- (120) ENCODE
- (121) ProSci
- (122) Horizon
- (123) The Signaling Pathways Project (SPP)
- (124) IID
- (125) VectorBuilder
- (126) SNPedia
- (127) BRCA Exchange
- (128) CIViC
- (129) ProteoGenix
- (130) dbSUPER
- (131) TISSUES
- (132) Gene ORGANizer
- (133) abm
- (134) Human Protein Atlas
- (135) GWAS Catalog
- (136) Monarch Initiative
- (137) DataMed
- (138) HumanCyc
- (139) UCNEbase
- (140) EPDnew
- (141) Applied Biosystems
- (142) GlyConnect
- (143) Aminode
- (144) GeneCopoeia
- (145) GPS-Prot
- (146) RNAcentral
- (147) LncRNADisease
- (148) LOVD
- (149) miR2Disease
- (150) DiseaseEnhancer
- (151) Boster Bio
- (152) Biorbyt
- (153) Biocompare
- (154) Mastermind
- (155) CTD^2 Dashboard
- (156) CraniofacialAtlas
- (157) GeneImprint
- (158) Synthego
- (159) ENA
- (160) GtRNAdb
- (161) LncBase
- (162) LncBook
- (163) LNCipedia
- (164) Modomics
- (165) PDBe
- (166) Rfam
- (167) SILVA
- (168) snOPY
- (169) SRPDB
- (170) GENCODE
- (171) TarBase
- (172) Open Targets Platform
- (173) 5SRRNADB
- (174) snoDB
- (175) MirGeneDB
- (176) Alliance of Genome Resources