Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus and phosphorylate nuclear targets. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] See more...

Aliases for MAPK4 Gene

Aliases for MAPK4 Gene

  • Mitogen-Activated Protein Kinase 4 2 3 4 5
  • Extracellular Signal-Regulated Kinase 4 3 4
  • MAP Kinase Isoform P63 3 4
  • EC 2.7.11.24 4 52
  • P63-MAPK 3 4
  • MAPK 4 3 4
  • PRKM4 3 4
  • ERK-4 3 4
  • ERK4 3 4
  • Erk3-Related 3
  • MAP Kinase 4 4
  • EC 2.7.11 52
  • P63MAPK 3

External Ids for MAPK4 Gene

Previous HGNC Symbols for MAPK4 Gene

  • PRKM4

Previous GeneCards Identifiers for MAPK4 Gene

  • GC18P048373
  • GC18P048125
  • GC18P047974
  • GC18P046441
  • GC18P046340
  • GC18P044941

Summaries for MAPK4 Gene

Entrez Gene Summary for MAPK4 Gene

  • Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus and phosphorylate nuclear targets. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

GeneCards Summary for MAPK4 Gene

MAPK4 (Mitogen-Activated Protein Kinase 4) is a Protein Coding gene. Diseases associated with MAPK4 include Pulmonary Immaturity. Among its related pathways are CCR5 Pathway in Macrophages and MicroRNAs in cardiomyocyte hypertrophy. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and protein kinase activity. An important paralog of this gene is MAPK6.

UniProtKB/Swiss-Prot Summary for MAPK4 Gene

  • Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK4/MAPK4 is phosphorylated at Ser-186 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK4/MAPK4. May promote entry in the cell cycle (By similarity).

Gene Wiki entry for MAPK4 Gene

Additional gene information for MAPK4 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for MAPK4 Gene

Genomics for MAPK4 Gene

GeneHancer (GH) Regulatory Elements for MAPK4 Gene

Promoters and enhancers for MAPK4 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH18J050559 Promoter/Enhancer 1.8 EPDnew Ensembl ENCODE CraniofacialAtlas 500.7 +0.4 429 3 ZIC2 POLR2A ZNF423 ZBTB26 EZH2 KLF9 ZBTB17 MXI1 PHF8 ZFHX2 MAPK4 MBD1 CXXC1 piR-54764-299
GH18J050790 Enhancer 1 Ensembl ENCODE dbSUPER 8.1 +234.1 234103 8 ZIC2 MYNN ZNF263 SPI1 JUND ZFHX2 ZNF777 CTCF SCRT1 RXRA SMAD4 RPL17P46 MRO MBD1 MAPK4 HNRNPA3P16 piR-48965-060
GH18J050527 Enhancer 0.6 ENCODE 12.3 -31.2 -31154 2.7 FOXA2 ZBTB33 JUND RAD21 RXRA MAX HNF4A MAFK ESR1 FOXA1 MAPK4 piR-55361-281
GH18J050724 Enhancer 1 Ensembl ENCODE CraniofacialAtlas 5.8 +166.5 166473 4.4 EP300 MEF2C BCL11A SRF MEF2B POLR2A BATF IRF4 POU2F2 SCRT1 MAPK4 HSALNG0121539 HSALNG0121540
GH18J050747 Enhancer 1 Ensembl ENCODE 4.7 +189.0 189014 2.6 ZSCAN5C ZIC2 ZBTB10 ZNF423 TRIM28 KLF7 ATF2 MXI1 ZNF341 OSR2 MEX3C ELAC1 MBD1 MAPK4 LOC105372116 HSALNG0121540 HSALNG0121539
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around MAPK4 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for MAPK4

Top Transcription factor binding sites by QIAGEN in the MAPK4 gene promoter:
  • AML1a
  • HNF-4alpha1
  • HOXA9
  • LCR-F1
  • Msx-1
  • NF-1
  • NF-1/L
  • Pax-6
  • SRF
  • SRF (504 AA)

Genomic Locations for MAPK4 Gene

Genomic Locations for MAPK4 Gene
chr18:50,560,087-50,731,826
(GRCh38/hg38)
Size:
171,740 bases
Orientation:
Plus strand
chr18:48,086,448-48,258,196
(GRCh37/hg19)
Size:
171,749 bases
Orientation:
Plus strand

Genomic View for MAPK4 Gene

Genes around MAPK4 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MAPK4 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MAPK4 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MAPK4 Gene

Proteins for MAPK4 Gene

  • Protein details for MAPK4 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P31152-MK04_HUMAN
    Recommended name:
    Mitogen-activated protein kinase 4
    Protein Accession:
    P31152
    Secondary Accessions:
    • A1A4C4
    • Q0VG04

    Protein attributes for MAPK4 Gene

    Size:
    587 amino acids
    Molecular mass:
    65922 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Homodimer. Heterodimer with ERK3/MAPK6. Interacts with (via FRIEDE motif) MAPKAPK5 (By similarity).
    SequenceCaution:
    • Sequence=CAA42411.1; Type=Frameshift; Evidence={ECO:0000305};

neXtProt entry for MAPK4 Gene

Selected DME Specific Peptides for MAPK4 Gene

P31152:
  • GCILAEM
  • GLKYIHSA
  • LSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCI
  • YIVQEYMETDLA
  • LFAGAHELEQMQLIL
  • DLKPANIFI
  • HSANVLHRDL
  • LKYIHSA
  • QLLRGLKY
  • VLHRDLK
  • TEDLVLKIGDFGLARI
  • KHALREIKIIRRLDHDNIVKV
  • LKIGDFG
  • PMDRLTAE

Post-translational modifications for MAPK4 Gene

  • Phosphorylated at Ser-186 by PAK1, PAK2 and PAK3 resulting in catalytic activation. Phosphorylated by MAPKAPK5 at other sites.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for MAPK4 Gene

Gene Families for MAPK4 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for MAPK4 Gene

Blocks:
  • ERK3/4 MAP kinase signature
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for MAPK4 Gene

GenScript: Design optimal peptide antigens:
  • Mitogen-activated protein kinase 4 (A1A4C4_HUMAN)
  • cDNA FLJ50121, highly similar to Homo sapiens mitogen-activated protein kinase 4 (MAPK4), mRNA (B4DEW2_HUMAN)
  • MAP kinase isoform p63 (MK04_HUMAN)
  • cDNA FLJ57847, highly similar to Homo sapiens mitogen-activated protein kinase 4 (MAPK4), mRNA (Q0VG04_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P31152

UniProtKB/Swiss-Prot:

MK04_HUMAN :
  • The FRIEDE motif is required for docking MAPKAPK5.
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Domain:
  • The FRIEDE motif is required for docking MAPKAPK5.
  • In contrast to classical MAPKs, the TXY motif within the activation loop is replaced by the SEG motif, whose phosphorylation activates the MAP kinases.
Family:
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
genes like me logo Genes that share domains with MAPK4: view

Function for MAPK4 Gene

Molecular function for MAPK4 Gene

UniProtKB/Swiss-Prot Function:
Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK4/MAPK4 is phosphorylated at Ser-186 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK4/MAPK4. May promote entry in the cell cycle (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.24;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.24;.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by phosphorylation at Ser-186.
GENATLAS Biochemistry:
mitogen-activated protein kinase 4 (p63),expressed in heart muscle,brain

Enzyme Numbers (IUBMB) for MAPK4 Gene

Phenotypes From GWAS Catalog for MAPK4 Gene

Gene Ontology (GO) - Molecular Function for MAPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity TAS,IEA --
GO:0004707 MAP kinase activity IEA,IBA 21873635
GO:0005515 protein binding IPI 22939624
genes like me logo Genes that share ontologies with MAPK4: view
genes like me logo Genes that share phenotypes with MAPK4: view

Animal Models for MAPK4 Gene

MGI Knock Outs for MAPK4:

Animal Model Products

  • Taconic Biosciences Mouse Models for MAPK4

CRISPR Products

miRNA for MAPK4 Gene

miRTarBase miRNAs that target MAPK4

Clone Products

  • Addgene plasmids for MAPK4

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MAPK4 Gene

Localization for MAPK4 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MAPK4 Gene

Cytoplasm. Nucleus. Note=Translocates to the cytoplasm following interaction with MAPKAPK5. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MAPK4 gene
Compartment Confidence
nucleus 5
cytosol 5
cytoskeleton 2
plasma membrane 1
extracellular 1
mitochondrion 1
peroxisome 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Golgi apparatus (2)
  • Midbody (2)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for MAPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IBA,ISS --
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IBA,ISS --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with MAPK4: view

Pathways & Interactions for MAPK4 Gene

PathCards logo

SuperPathways for MAPK4 Gene

SuperPathway Contained pathways
1 IL-2 Pathway
.59
.54
.49
.36
.35
2 CCR5 Pathway in Macrophages
.52
.33
3 GPCR Pathway
.58
.58
4 EphB-EphrinB Signaling
.58
.58
5 TGF-Beta Pathway
.60
.43
genes like me logo Genes that share pathways with MAPK4: view

Pathways by source for MAPK4 Gene

1 KEGG pathway for MAPK4 Gene
2 Tocris pathways for MAPK4 Gene
25 Qiagen pathways for MAPK4 Gene
  • 14-3-3 Induced Apoptosis
  • 4-1BB Pathway
  • Aldosterone Signaling in Epithelial Cells
  • Androgen Signaling
  • Breast Cancer Regulation by Stathmin1

SIGNOR curated interactions for MAPK4 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for MAPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade IEA --
GO:0006468 protein phosphorylation TAS,IEA 7969157
GO:0007049 cell cycle IEA --
GO:0010468 regulation of gene expression IBA 21873635
GO:0016310 phosphorylation IEA --
genes like me logo Genes that share ontologies with MAPK4: view

Drugs & Compounds for MAPK4 Gene

(5) Drugs for MAPK4 Gene - From: DrugBank, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Aspirin Approved, Vet_approved Pharma Channel blocker, Target 1440
fostamatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors 0
Magnesium Approved, Experimental, Investigational Pharma 0
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0

(1) Additional Compounds for MAPK4 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor 58-64-0
genes like me logo Genes that share compounds with MAPK4: view

Transcripts for MAPK4 Gene

mRNA/cDNA for MAPK4 Gene

3 REFSEQ mRNAs :
11 NCBI additional mRNA sequence :
6 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Clone Products

  • Addgene plasmids for MAPK4

Alternative Splicing Database (ASD) splice patterns (SP) for MAPK4 Gene

No ASD Table

Relevant External Links for MAPK4 Gene

GeneLoc Exon Structure for
MAPK4

Expression for MAPK4 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for MAPK4 Gene

mRNA differential expression in normal tissues according to GTEx for MAPK4 Gene

This gene is overexpressed in Brain - Nucleus accumbens (basal ganglia) (x6.4), Brain - Caudate (basal ganglia) (x6.2), and Brain - Putamen (basal ganglia) (x5.7).

Protein differential expression in normal tissues from HIPED for MAPK4 Gene

This gene is overexpressed in Brain (39.5), Retina (13.7), and Heart (13.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for MAPK4 Gene



Protein tissue co-expression partners for MAPK4 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for MAPK4

SOURCE GeneReport for Unigene cluster for MAPK4 Gene:

Hs.433728

mRNA Expression by UniProt/SwissProt for MAPK4 Gene:

P31152-MK04_HUMAN
Tissue specificity: High expression in heart and brain.

Evidence on tissue expression from TISSUES for MAPK4 Gene

  • Nervous system(4.8)
genes like me logo Genes that share expression patterns with MAPK4: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAPK4 Gene

Orthologs for MAPK4 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for MAPK4 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MAPK4 31 30
  • 99.43 (n)
OneToOne
cow
(Bos Taurus)
Mammalia MAPK4 31
  • 93 (a)
OneToOne
dog
(Canis familiaris)
Mammalia MAPK4 31 30
  • 90.95 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Mapk4 17 31 30
  • 88.05 (n)
rat
(Rattus norvegicus)
Mammalia Mapk4 30
  • 87.42 (n)
oppossum
(Monodelphis domestica)
Mammalia MAPK4 31
  • 85 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia MAPK4 31
  • 84 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia MAPK4 31
  • 81 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia LOC100498202 30
  • 72.65 (n)
zebrafish
(Danio rerio)
Actinopterygii mapk4 31 30
  • 65.44 (n)
OneToOne
worm
(Caenorhabditis elegans)
Secernentea Y106G6D.4 32
  • 33 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes FUS3 31
  • 34 (a)
ManyToMany
KSS1 31
  • 33 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.7149 31
  • 19 (a)
OneToMany
Species where no ortholog for MAPK4 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for MAPK4 Gene

ENSEMBL:
Gene Tree for MAPK4 (if available)
TreeFam:
Gene Tree for MAPK4 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for MAPK4: view image

Paralogs for MAPK4 Gene

(47) SIMAP similar genes for MAPK4 Gene using alignment to 6 proteins:

  • MK04_HUMAN
  • A1A4C4_HUMAN
  • B4DEW2_HUMAN
  • K7ELV1_HUMAN
  • K7EN18_HUMAN
  • Q0VG04_HUMAN
genes like me logo Genes that share paralogs with MAPK4: view

Variants for MAPK4 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for MAPK4 Gene

SNP ID Clinical significance and condition Chr 18 pos Variation AA Info Type
rs3752087 - p.Val38Met
rs3752089 - p.Arg371Pro

Additional dbSNP identifiers (rs#s) for MAPK4 Gene

Structural Variations from Database of Genomic Variants (DGV) for MAPK4 Gene

Variant ID Type Subtype PubMed ID
dgv987e212 CNV loss 25503493
esv2717094 CNV deletion 23290073
esv34028 CNV loss 18971310
nsv1071462 CNV deletion 25765185
nsv130821 CNV deletion 16902084
nsv2303 CNV insertion 18451855
nsv833651 CNV loss 17160897
nsv953542 CNV deletion 24416366
nsv9630 CNV loss 18304495

Variation tolerance for MAPK4 Gene

Residual Variation Intolerance Score: 16.6% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.59; 30.70% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for MAPK4 Gene

Human Gene Mutation Database (HGMD)
MAPK4
SNPedia medical, phenotypic, and genealogical associations of SNPs for
MAPK4

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAPK4 Gene

Disorders for MAPK4 Gene

MalaCards: The human disease database

(1) MalaCards diseases for MAPK4 Gene - From: DISEASES

Disorder Aliases PubMed IDs
pulmonary immaturity
  • primary atelectasis of newborn
- elite association - COSMIC cancer census association via MalaCards
Search MAPK4 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for MAPK4

genes like me logo Genes that share disorders with MAPK4: view

No data available for UniProtKB/Swiss-Prot and Genatlas for MAPK4 Gene

Publications for MAPK4 Gene

  1. Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway. (PMID: 21177870) Déléris P … Meloche S (The Journal of biological chemistry 2011) 3 4 54
  2. Docking of PRAK/MK5 to the atypical MAPKs ERK3 and ERK4 defines a novel MAPK interaction motif. (PMID: 19473979) Aberg E … Seternes OM (The Journal of biological chemistry 2009) 3 23 54
  3. Activation loop phosphorylation of the atypical MAP kinases ERK3 and ERK4 is required for binding, activation and cytoplasmic relocalization of MK5. (PMID: 18720373) Déléris P … Meloche S (Journal of cellular physiology 2008) 3 23 54
  4. Characterization of the atypical MAPK ERK4 and its activation of the MAPK-activated protein kinase MK5. (PMID: 16973613) Kant S … Gaestel M (The Journal of biological chemistry 2006) 3 23 54
  5. Genomic loci of human mitogen-activated protein kinases. (PMID: 8290275) Li L … Davis RJ (Oncogene 1994) 2 3 54

Products for MAPK4 Gene

Sources for MAPK4 Gene