The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase contains a dual leucine-zipper motif, and has been shown to form dimers/oligomers through its leucine-zipper motif. This kinase can phosphorylate and activate MAPK8/JNK, MAP2K7/MKK7, which suggests a role in the JNK signaling pathway. [provided by RefSeq, Jul 2008] See more...

Aliases for MAP3K13 Gene

Aliases for MAP3K13 Gene

  • Mitogen-Activated Protein Kinase Kinase Kinase 13 2 3 4 5
  • Leucine Zipper-Bearing Kinase 2 3 4
  • LZK 2 3 4
  • Mixed Lineage Kinase 3 4
  • EC 2.7.11.25 4 51
  • MEKK13 2 3
  • MLK 3 4
  • EC 2.7.11 51
  • MAP3K13 5

External Ids for MAP3K13 Gene

Previous GeneCards Identifiers for MAP3K13 Gene

  • GC03P181938
  • GC03P186229
  • GC03P186482
  • GC03P186401
  • GC03P186563
  • GC03P185000
  • GC03P182490

Summaries for MAP3K13 Gene

Entrez Gene Summary for MAP3K13 Gene

  • The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase contains a dual leucine-zipper motif, and has been shown to form dimers/oligomers through its leucine-zipper motif. This kinase can phosphorylate and activate MAPK8/JNK, MAP2K7/MKK7, which suggests a role in the JNK signaling pathway. [provided by RefSeq, Jul 2008]

GeneCards Summary for MAP3K13 Gene

MAP3K13 (Mitogen-Activated Protein Kinase Kinase Kinase 13) is a Protein Coding gene. Diseases associated with MAP3K13 include Peripheral Demyelinating Neuropathy, Central Dysmyelination, Waardenburg Syndrome, And Hirschsprung Disease and Parkinson Disease, Late-Onset. Among its related pathways are Signal transduction_JNK pathway and Signaling events mediated by VEGFR1 and VEGFR2. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and transferase activity, transferring phosphorus-containing groups. An important paralog of this gene is MAP3K12.

UniProtKB/Swiss-Prot Summary for MAP3K13 Gene

  • Activates the JUN N-terminal pathway through activation of the MAP kinase kinase MAP2K7. Acts synergistically with PRDX3 to regulate the activation of NF-kappa-B in the cytosol. This activation is kinase-dependent and involves activating the IKK complex, the IKBKB-containing complex that phosphorylates inhibitors of NF-kappa-B.

Gene Wiki entry for MAP3K13 Gene

Additional gene information for MAP3K13 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for MAP3K13 Gene

Genomics for MAP3K13 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for MAP3K13 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH03J185325 Promoter/Enhancer 2.2 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 638.4 +46.5 46526 7.6 CEBPG GATAD2A PRDM10 REST RCOR2 BACH1 FOXA1 PRDM1 RBFOX2 PKNOX1 MAP3K13 EHHADH piR-50391-008 lnc-EHHADH-2 TMEM41A
GH03J185282 Promoter/Enhancer 2 EPDnew Ensembl ENCODE CraniofacialAtlas 626.9 +0.2 163 2.6 BRCA1 SP1 CREB1 GATAD2A ATF7 TEAD4 ZNF629 NFKBIZ ZNF692 POLR2A MAP3K13 EHHADH lnc-EHHADH-1 C3orf70 lnc-EHHADH-2 TMEM41A
GH03J185361 Promoter/Enhancer 2 EPDnew Ensembl ENCODE CraniofacialAtlas 607.4 +80.3 80296 3.1 RNF2 SP1 CREB1 ZNF629 ZNF692 POLR2A ZHX2 FOXA1 PRDM1 PHF21A MAP3K13 TRA2B piR-38129-077 piR-50391-008 TMEM41A
GH03J185316 Enhancer 1.2 FANTOM5 ENCODE dbSUPER 39 +34.5 34509 2.3 GATAD2A ATF7 LEF1 FOXA1 RELA MTA1 RXRB SP1 DPF2 HDAC1 MAP3K13 EHHADH C3orf70 lnc-EHHADH-2 piR-50391-008 TMEM41A
GH03J185309 Enhancer 0.9 Ensembl ENCODE 38.8 +26.2 26188 2.3 GATAD2A CTCF TEAD4 REST RAD21 TRIM22 CEBPA SOX13 CEBPB SMC3 MAP3K13 EHHADH C3orf70 lnc-EHHADH-2 piR-50391-008 TMEM41A
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around MAP3K13 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for MAP3K13

Top Transcription factor binding sites by QIAGEN in the MAP3K13 gene promoter:
  • AP-1
  • ATF-2
  • c-Jun
  • FOXJ2
  • FOXJ2 (long isoform)
  • FOXO3
  • HNF-1
  • HNF-1A
  • Sox5

Genomic Locations for MAP3K13 Gene

Genomic Locations for MAP3K13 Gene
chr3:185,282,938-185,489,094
(GRCh38/hg38)
Size:
206,157 bases
Orientation:
Plus strand
chr3:185,000,729-185,206,885
(GRCh37/hg19)
Size:
206,157 bases
Orientation:
Plus strand

Genomic View for MAP3K13 Gene

Genes around MAP3K13 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MAP3K13 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MAP3K13 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MAP3K13 Gene

Proteins for MAP3K13 Gene

  • Protein details for MAP3K13 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O43283-M3K13_HUMAN
    Recommended name:
    Mitogen-activated protein kinase kinase kinase 13
    Protein Accession:
    O43283
    Secondary Accessions:
    • B2R6U2
    • B4DLE3
    • B4DMV2
    • B4DZJ4
    • D3DNU1
    • Q05BY6
    • Q15450
    • Q2NKN3

    Protein attributes for MAP3K13 Gene

    Size:
    966 amino acids
    Molecular mass:
    108296 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Homodimer; forms dimers through the leucine-zipper motif. Interacts with the C-terminus of MAPK8IP1 through the kinase catalytic domain. Binds PRDX3. Associates with the IKK complex through the kinase domain.
    SequenceCaution:
    • Sequence=AAI11727.1; Type=Erroneous translation; Note=Wrong choice of CDS.; Evidence={ECO:0000305}; Sequence=BAG59505.1; Type=Erroneous termination; Note=Truncated C-terminus.; Evidence={ECO:0000305};
    Miscellaneous:
    • [Isoform 2]: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Alternative splice isoforms for MAP3K13 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for MAP3K13 Gene

Selected DME Specific Peptides for MAP3K13 Gene

O43283:
  • RRREELRHALDIREHYERKLERANNLYMEL
  • STFSSEN
  • LWELLTGE
  • SDGLSDKECAVRRVKTQMSLGKLC
  • LMHLDIA
  • GQLYEVLRAGR
  • GPWGCCQA
  • HLDIASADVL
  • EEEGEVDSEVEFPRRQRPHRCISS
  • TPQETYFKSQAEWREEVK
  • WMAPEVI
  • EEVAIKKVREQ
  • CPDGFKIL
  • LWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSTCPDG
  • IGKAYST
  • GMNYLHLHKIIHRDLKSPN
  • HRDLKSPN
  • GFLEGLFGCLRPVW
  • VKISDFGTSKELSDKSTKMSFAGTVAW
  • KISDFGTSK
  • GSGAQGAVFLG
  • WEVPFEEI
  • HFEKIKSEGTC
  • ETDIKHLRKLKHPNII
  • NNLRYFGPAAALRSPLSNH
  • VEKKYPGTYKRHPVRPI
  • RYRSKPRHRR
  • RNRPSFRQ

Post-translational modifications for MAP3K13 Gene

Domains & Families for MAP3K13 Gene

Gene Families for MAP3K13 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for MAP3K13 Gene

GenScript: Design optimal peptide antigens:
  • Mixed lineage kinase (M3K13_HUMAN)

Graphical View of Domain Structure for InterPro Entry

O43283

UniProtKB/Swiss-Prot:

M3K13_HUMAN :
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
Family:
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
genes like me logo Genes that share domains with MAP3K13: view

Function for MAP3K13 Gene

Molecular function for MAP3K13 Gene

UniProtKB/Swiss-Prot Function:
Activates the JUN N-terminal pathway through activation of the MAP kinase kinase MAP2K7. Acts synergistically with PRDX3 to regulate the activation of NF-kappa-B in the cytosol. This activation is kinase-dependent and involves activating the IKK complex, the IKBKB-containing complex that phosphorylates inhibitors of NF-kappa-B.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.25; Evidence={ECO:0000269|PubMed:9353328};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.25; Evidence={ECO:0000269|PubMed:9353328};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by autophosphorylation and homodimerization.
GENATLAS Biochemistry:
mitogen activated protein (MAP/ERK) kinase kinase kinase 13,mixed lineage kinase family,most strongly expressed in pancreas

Enzyme Numbers (IUBMB) for MAP3K13 Gene

Phenotypes From GWAS Catalog for MAP3K13 Gene

Gene Ontology (GO) - Molecular Function for MAP3K13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA,IBA 21873635
GO:0004674 protein serine/threonine kinase activity IEA,IDA 9353328
GO:0004706 JUN kinase kinase kinase activity IBA,ISS --
GO:0004709 MAP kinase kinase kinase activity IBA,IDA 11726277
genes like me logo Genes that share ontologies with MAP3K13: view
genes like me logo Genes that share phenotypes with MAP3K13: view

Animal Model Products

  • Taconic Biosciences Mouse Models for MAP3K13

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MAP3K13

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for MAP3K13 Gene

Localization for MAP3K13 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MAP3K13 Gene

Cytoplasm. Membrane. Peripheral membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MAP3K13 gene
Compartment Confidence
nucleus 3
cytosol 3
plasma membrane 2
extracellular 2
cytoskeleton 2
mitochondrion 2
peroxisome 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Centriolar satellite (2)
  • Cytosol (2)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for MAP3K13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0016020 membrane IEA,IDA 9353328
genes like me logo Genes that share ontologies with MAP3K13: view

Pathways & Interactions for MAP3K13 Gene

genes like me logo Genes that share pathways with MAP3K13: view

Pathways by source for MAP3K13 Gene

1 GeneGo (Thomson Reuters) pathway for MAP3K13 Gene
  • Signal transduction_JNK pathway
5 Qiagen pathways for MAP3K13 Gene
  • MAPK Family Pathway
  • NFAT and Cardiac Hypertrophy
  • PACAP Signaling
  • TNFR2 Pathway
  • WNT Signaling

SIGNOR curated interactions for MAP3K13 Gene

Activates:

Gene Ontology (GO) - Biological Process for MAP3K13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000186 activation of MAPKK activity IDA 11726277
GO:0006468 protein phosphorylation IEA,IDA 9353328
GO:0007254 JNK cascade IBA,IDA 9353328
GO:0007256 activation of JNKK activity ISS --
GO:0007257 activation of JUN kinase activity ISS --
genes like me logo Genes that share ontologies with MAP3K13: view

Drugs & Compounds for MAP3K13 Gene

(9) Drugs for MAP3K13 Gene - From: DrugBank, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
fostamatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors 0
Magnesium Approved, Experimental, Investigational Pharma 0
ATP Investigational Nutra Agonist, Activator, Partial agonist, Antagonist, Full agonist, Gating inhibitor, Pore Blocker, Potentiation 0

(2) Additional Compounds for MAP3K13 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Agonist, Full agonist, Partial agonist, Gating inhibitor, Antagonist 58-64-0
genes like me logo Genes that share compounds with MAP3K13: view

Transcripts for MAP3K13 Gene

mRNA/cDNA for MAP3K13 Gene

3 REFSEQ mRNAs :
14 NCBI additional mRNA sequence :
15 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for MAP3K13

Alternative Splicing Database (ASD) splice patterns (SP) for MAP3K13 Gene

No ASD Table

Relevant External Links for MAP3K13 Gene

GeneLoc Exon Structure for
MAP3K13

Expression for MAP3K13 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for MAP3K13 Gene

Protein differential expression in normal tissues from HIPED for MAP3K13 Gene

This gene is overexpressed in Plasma (69.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for MAP3K13 Gene



Protein tissue co-expression partners for MAP3K13 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for MAP3K13

SOURCE GeneReport for Unigene cluster for MAP3K13 Gene:

Hs.591306

mRNA Expression by UniProt/SwissProt for MAP3K13 Gene:

O43283-M3K13_HUMAN
Tissue specificity: Expressed in the adult brain, liver, placenta and pancreas, with expression strongest in the pancreas.

Evidence on tissue expression from TISSUES for MAP3K13 Gene

  • Nervous system(4.8)
  • Lung(2.9)
  • Kidney(2.9)
  • Liver(2.6)
  • Heart(2.4)
  • Adrenal gland(2.4)
  • Skin(2.3)
  • Blood(2.3)
  • Muscle(2.3)
  • Intestine(2.3)
genes like me logo Genes that share expression patterns with MAP3K13: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAP3K13 Gene

Orthologs for MAP3K13 Gene

This gene was present in the common ancestor of animals.

Orthologs for MAP3K13 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia MAP3K13 30 31
  • 99.14 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia MAP3K13 30 31
  • 91.37 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia MAP3K13 30 31
  • 91.34 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia MAP3K13 31
  • 87 (a)
OneToOne
Mouse
(Mus musculus)
Mammalia Map3k13 30 17 31
  • 84.78 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Map3k13 30
  • 84.36 (n)
Oppossum
(Monodelphis domestica)
Mammalia MAP3K13 31
  • 84 (a)
OneToOne
Chicken
(Gallus gallus)
Aves MAP3K13 30 31
  • 76.41 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia MAP3K13 31
  • 79 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia LOC100493878 30
  • 69.4 (n)
Zebrafish
(Danio rerio)
Actinopterygii si:ch211-45c16.2 30
  • 67.94 (n)
MAP3K13 31
  • 64 (a)
OneToOne
Fruit Fly
(Drosophila melanogaster)
Insecta CG8789 32
  • 62 (a)
wnd 31
  • 36 (a)
OneToMany
Worm
(Caenorhabditis elegans)
Secernentea dlk-1 31
  • 31 (a)
OneToMany
Species where no ortholog for MAP3K13 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for MAP3K13 Gene

ENSEMBL:
Gene Tree for MAP3K13 (if available)
TreeFam:
Gene Tree for MAP3K13 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for MAP3K13: view image

Paralogs for MAP3K13 Gene

(11) SIMAP similar genes for MAP3K13 Gene using alignment to 6 proteins:

  • M3K13_HUMAN
  • C9IYH2_HUMAN
  • C9J4W2_HUMAN
  • C9JP65_HUMAN
  • F8WF41_HUMAN
  • H7C459_HUMAN

Pseudogenes.org Pseudogenes for MAP3K13 Gene

genes like me logo Genes that share paralogs with MAP3K13: view

Variants for MAP3K13 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for MAP3K13 Gene

SNP ID Clinical significance and condition Chr 03 pos Variation AA Info Type
784471 Benign: not provided 185,465,753(+) G/A SYNONYMOUS_VARIANT
VAR_040710 A metastatic melanoma sample p.Pro746Leu
rs35266179 - p.Glu44Lys
rs3732576 - p.Arg915His
rs56309231 - p.Glu712Lys

Additional dbSNP identifiers (rs#s) for MAP3K13 Gene

Structural Variations from Database of Genomic Variants (DGV) for MAP3K13 Gene

Variant ID Type Subtype PubMed ID
dgv183n111 CNV deletion 26073780
dgv2652n106 CNV deletion 24896259
dgv2653n106 CNV duplication 24896259
dgv5002n100 CNV gain 25217958
esv1687636 CNV insertion 17803354
esv1742989 CNV deletion 17803354
esv2339714 CNV deletion 18987734
esv2545135 CNV deletion 19546169
esv2659506 CNV deletion 23128226
esv2726325 CNV deletion 23290073
esv2832347 CNV deletion 24192839
esv3258 CNV loss 18987735
esv3563020 CNV deletion 23714750
esv3598966 CNV gain 21293372
esv3598967 CNV loss 21293372
esv3598968 CNV loss 21293372
esv3893837 CNV gain 25118596
esv7825 CNV loss 19470904
nsv1074113 CNV deletion 25765185
nsv1074114 CNV deletion 25765185
nsv1117357 CNV tandem duplication 24896259
nsv1120466 CNV tandem duplication 24896259
nsv1129705 CNV tandem duplication 24896259
nsv1133331 CNV tandem duplication 24896259
nsv1133332 CNV tandem duplication 24896259
nsv1139184 CNV deletion 24896259
nsv1139185 CNV deletion 24896259
nsv1140347 OTHER inversion 24896259
nsv1146973 CNV duplication 26484159
nsv1152810 CNV insertion 26484159
nsv237556 CNV deletion 16902084
nsv441852 CNV loss 18776908
nsv822366 CNV loss 20364138
nsv829817 CNV gain 17160897
nsv829818 CNV loss 17160897
nsv955530 CNV deletion 24416366
nsv967100 CNV duplication 23825009

Variation tolerance for MAP3K13 Gene

Residual Variation Intolerance Score: 13.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.64; 45.56% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for MAP3K13 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
MAP3K13

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAP3K13 Gene

Disorders for MAP3K13 Gene

MalaCards: The human disease database

(2) MalaCards diseases for MAP3K13 Gene - From: DISEASES

- elite association - COSMIC cancer census association via MalaCards

Additional Disease Information for MAP3K13

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
genes like me logo Genes that share disorders with MAP3K13: view

No data available for UniProtKB/Swiss-Prot and Genatlas for MAP3K13 Gene

Publications for MAP3K13 Gene

  1. Molecular cloning and functional expression of a cDNA encoding a new member of mixed lineage protein kinase from human brain. (PMID: 9353328) Sakuma H … Kawasaki T (The Journal of biological chemistry 1997) 2 3 4 23
  2. Identification and characterization of functional domains in a mixed lineage kinase LZK. (PMID: 11163770) Ikeda A … Kawasaki T (FEBS letters 2001) 3 4 23
  3. Mixed lineage kinase LZK forms a functional signaling complex with JIP-1, a scaffold protein of the c-Jun NH(2)-terminal kinase pathway. (PMID: 11726277) Ikeda A … Kawasaki T (Journal of biochemistry 2001) 3 4 23
  4. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 41
  5. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4

Products for MAP3K13 Gene

  • Signalway Proteins for MAP3K13

Sources for MAP3K13 Gene