The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides... See more...

Aliases for LIPE Gene

Aliases for LIPE Gene

  • Lipase E, Hormone Sensitive Type 2 3 5
  • HSL 2 3 4
  • Monoacylglycerol Lipase LIPE 3 4
  • Lipase, Hormone-Sensitive 2 3
  • Hormone-Sensitive Lipase 3 4
  • Retinyl Ester Hydrolase 3 4
  • EC 3.1.1.79 4 50
  • REH 3 4
  • EC 3.1.1.23 4
  • AOMS4 3
  • FPLD6 3
  • LIPE 5
  • LHS 3

External Ids for LIPE Gene

Previous GeneCards Identifiers for LIPE Gene

  • GC19M043552
  • GC19M043297
  • GC19M047581
  • GC19M047597
  • GC19M042906
  • GC19M039335

Summaries for LIPE Gene

Entrez Gene Summary for LIPE Gene

  • The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids. [provided by RefSeq, Jul 2008]

GeneCards Summary for LIPE Gene

LIPE (Lipase E, Hormone Sensitive Type) is a Protein Coding gene. Diseases associated with LIPE include Lipodystrophy, Familial Partial, Type 6 and Abdominal Obesity-Metabolic Syndrome 4. Among its related pathways are Apelin signaling pathway and triacylglycerol biosynthesis. Gene Ontology (GO) annotations related to this gene include protein kinase binding and triglyceride lipase activity.

UniProtKB/Swiss-Prot Summary for LIPE Gene

  • Lipase with broad substrate specificity, catalyzing the hydrolysis of triacylglycerols (TAGs), diacylglycerols (DAGs), monoacylglycerols (MAGs), cholesteryl esters and retinyl esters (PubMed:8812477, PubMed:15955102, PubMed:15716583, PubMed:19800417). Shows a preferential hydrolysis of DAGs over TAGs and MAGs and preferentially hydrolyzes the fatty acid (FA) esters at the sn-3 position of the glycerol backbone in DAGs (PubMed:19800417). Preferentially hydrolyzes FA esters at the sn-1 and sn-2 positions of the glycerol backbone in TAGs (By similarity). Catalyzes the hydrolysis of 2-arachidonoylglycerol, an endocannabinoid and of 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor (By similarity). In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production (By similarity).

Gene Wiki entry for LIPE Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for LIPE Gene

Genomics for LIPE Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for LIPE Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH19J042419 Promoter/Enhancer 2.5 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 255.9 +4.9 4938 5.2 SP1 MYC JUND ZNF580 ZMYM3 POLR2A ZIC2 CTCF REST TRIM22 LIPE MF281430-044 CD177 ENSG00000268605 LIPE-AS1 CNFN
GH19J042427 Promoter/Enhancer 1 EPDnew Ensembl ENCODE dbSUPER 250.7 +0.1 146 0.9 ZIC2 SCRT2 LIPE piR-58703 CD177 LIPE-AS1 CNFN
GH19J042449 Enhancer 1.6 FANTOM5 Ensembl ENCODE dbSUPER 33.7 -25.9 -25880 9.4 BCLAF1 SP1 ZNF207 NCOR1 ZNF654 ZNF600 KLF9 CEBPA ZNF10 ATF3 LIPE LIPE-AS1 CNFN CXCL17 PSG8 ENSG00000268355 CD177 CEACAM1 piR-57614
GH19J042267 Promoter/Enhancer 2.6 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 6.9 +156.5 156533 6.9 BCLAF1 SP1 ZNF207 NCOR1 IKZF1 MYC ZNF600 SIX5 JUND ZNF580 CIC piR-36065 ZNF526 ZNF574 CCDC97 DEDD2 MEGF8 CEACAM3 PAFAH1B3 PRR19
GH19J042183 Enhancer 1.2 Ensembl ENCODE dbSUPER 10 +240.1 240120 11.8 IKZF1 ZNF654 ZNF600 ZNF10 ZIC2 ZBTB10 CTCF REST TRIM22 ZNF639 lnc-DEDD2-3 GRIK5 POU2F2-AS1 DEDD2 ZNF526 LIPE-AS1 LIPE HSALNG0126273 POU2F2
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around LIPE on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for LIPE

Top Transcription factor binding sites by QIAGEN in the LIPE gene promoter:
  • AML1a
  • ATF
  • c-Ets-1
  • Evi-1
  • p53
  • Pax-4a
  • PPAR-alpha
  • Sp1

Genomic Locations for LIPE Gene

Latest Assembly
chr19:42,401,512-42,427,421
(GRCh38/hg38)
Size:
25,910 bases
Orientation:
Minus strand

Previous Assembly
chr19:42,905,666-42,931,540
(GRCh37/hg19 by Entrez Gene)
Size:
25,875 bases
Orientation:
Minus strand

chr19:42,905,659-42,931,578
(GRCh37/hg19 by Ensembl)
Size:
25,920 bases
Orientation:
Minus strand

Genomic View for LIPE Gene

Genes around LIPE on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
LIPE Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for LIPE Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for LIPE Gene

Proteins for LIPE Gene

  • Protein details for LIPE Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q05469-LIPS_HUMAN
    Recommended name:
    Hormone-sensitive lipase
    Protein Accession:
    Q05469
    Secondary Accessions:
    • Q3LRT2
    • Q6NSL7

    Protein attributes for LIPE Gene

    Size:
    1076 amino acids
    Molecular mass:
    116598 Da
    Quaternary structure:
    • Monomer and homodimer (By similarity). Interacts with CAVIN1 in the adipocyte cytoplasm (PubMed:17026959). Interacts with PLIN5 (By similarity).

    Alternative splice isoforms for LIPE Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for LIPE Gene

Selected DME Specific Peptides for LIPE Gene

Q05469:
  • QNLDVHFWKAFWNITE
  • ASPSRLLSLMD
  • HGGGFVAQTS
  • PSTPSDVNF
  • ETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFR
  • GDSAGGNL
  • LTVTISPPLAHTGP
  • SIDYSLAPEAPFPRALEECF
  • MDLRTMTQSLV
  • LLPLSVLSKCVS
  • YYAQRLL
  • SHNLAELEAYLAALTQLRA
  • MRRSVSEAALAQP
  • AFFSSQGPGETA

Post-translational modifications for LIPE Gene

  • Phosphorylation by AMPK reduces its translocation towards the lipid droplets.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibodies for research

  • Santa Cruz Biotechnology (SCBT) Antibodies for LIPE

Domains & Families for LIPE Gene

Gene Families for LIPE Gene

HGNC:
Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Potential drug targets
  • Predicted intracellular proteins

Protein Domains for LIPE Gene

InterPro:
Blocks:
  • Lipolytic enzyme
  • Hormone-sensitive lipase, N-terminal

Suggested Antigen Peptide Sequences for LIPE Gene

GenScript: Design optimal peptide antigens:
  • Hormone-sensitive lipase (LIPS_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q05469

UniProtKB/Swiss-Prot:

LIPS_HUMAN :
  • Belongs to the 'GDXG' lipolytic enzyme family.
Family:
  • Belongs to the 'GDXG' lipolytic enzyme family.
genes like me logo Genes that share domains with LIPE: view

Function for LIPE Gene

Molecular function for LIPE Gene

UniProtKB/Swiss-Prot Function:
Lipase with broad substrate specificity, catalyzing the hydrolysis of triacylglycerols (TAGs), diacylglycerols (DAGs), monoacylglycerols (MAGs), cholesteryl esters and retinyl esters (PubMed:8812477, PubMed:15955102, PubMed:15716583, PubMed:19800417). Shows a preferential hydrolysis of DAGs over TAGs and MAGs and preferentially hydrolyzes the fatty acid (FA) esters at the sn-3 position of the glycerol backbone in DAGs (PubMed:19800417). Preferentially hydrolyzes FA esters at the sn-1 and sn-2 positions of the glycerol backbone in TAGs (By similarity). Catalyzes the hydrolysis of 2-arachidonoylglycerol, an endocannabinoid and of 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor (By similarity). In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a diacylglycerol + H2O = a fatty acid + a monoacylglycerol + H(+); Xref=Rhea:RHEA:32731, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17408, ChEBI:CHEBI:18035, ChEBI:CHEBI:28868; EC=3.1.1.79; Evidence={ECO:0000269|PubMed:19800417, ECO:0000269|PubMed:8812477};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+); Xref=Rhea:RHEA:12044, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17855, ChEBI:CHEBI:18035, ChEBI:CHEBI:28868; EC=3.1.1.79; Evidence={ECO:0000269|PubMed:15955102, ECO:0000269|PubMed:19800417};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a monoacylglycerol + H2O = a fatty acid + glycerol + H(+); Xref=Rhea:RHEA:15245, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17408, ChEBI:CHEBI:17754, ChEBI:CHEBI:28868; EC=3.1.1.79; Evidence={ECO:0000250|UniProtKB:P15304};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=Hydrolyzes glycerol monoesters of long-chain fatty acids.; EC=3.1.1.23; Evidence={ECO:0000250|UniProtKB:P54310};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(9Z)-octadecenoate + 1,2-di-(9Z-octadecenoyl)-glycerol + H(+) = 1,2,3-tri-(9Z-octadecenoyl)-glycerol + H2O; Xref=Rhea:RHEA:38379, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30823, ChEBI:CHEBI:52323, ChEBI:CHEBI:53753; Evidence={ECO:0000269|PubMed:19800417};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=2,3-di-(9Z)-octadecenoyl-sn-glycerol + H2O = (9Z)-octadecenoate + 2-(9Z-octadecenoyl)-glycerol + H(+); Xref=Rhea:RHEA:38383, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30823, ChEBI:CHEBI:73990, ChEBI:CHEBI:75824; Evidence={ECO:0000269|PubMed:19800417};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=cholesteryl (9Z-octadecenoate) + H2O = (9Z)-octadecenoate + cholesterol + H(+); Xref=Rhea:RHEA:33875, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:16113, ChEBI:CHEBI:30823, ChEBI:CHEBI:46898; Evidence={ECO:0000269|PubMed:15716583};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1,2,3-tri-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + di-(9Z)-octadecenoylglycerol + H(+); Xref=Rhea:RHEA:38575, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30823, ChEBI:CHEBI:53753, ChEBI:CHEBI:75945; Evidence={ECO:0000269|PubMed:15955102};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=all-trans-retinyl hexadecanoate + H2O = all-trans-retinol + H(+) + hexadecanoate; Xref=Rhea:RHEA:13933, ChEBI:CHEBI:7896, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17336, ChEBI:CHEBI:17616; Evidence={ECO:0000269|PubMed:15955102};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1,2-di-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + (9Z-octadecenoyl)-glycerol + H(+); Xref=Rhea:RHEA:38455, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30823, ChEBI:CHEBI:52323, ChEBI:CHEBI:75937; Evidence={ECO:0000250|UniProtKB:P54310};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-glycerol + H2O = (5Z,8Z,11Z,14Z)-eicosatetraenoate + glycerol + H(+); Xref=Rhea:RHEA:26132, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17754, ChEBI:CHEBI:32395, ChEBI:CHEBI:52392; Evidence={ECO:0000250|UniProtKB:P54310};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + glycerol + H(+); Xref=Rhea:RHEA:38487, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17754, ChEBI:CHEBI:30823, ChEBI:CHEBI:75342; Evidence={ECO:0000250|UniProtKB:P54310};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=2-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + glycerol + H(+); Xref=Rhea:RHEA:38491, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17754, ChEBI:CHEBI:30823, ChEBI:CHEBI:73990; Evidence={ECO:0000250|UniProtKB:P54310};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-O-hexadecyl-2-acetyl-sn-glycerol + H2O = 1-O-hexadecyl-sn-glycerol + acetate + H(+); Xref=Rhea:RHEA:38563, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30089, ChEBI:CHEBI:34115, ChEBI:CHEBI:75936; Evidence={ECO:0000250|UniProtKB:P54310};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1,2-di-(9Z-octadecenoyl)-sn-glycerol + H2O = (9Z)-octadecenoate + (9Z-octadecenoyl)-glycerol + H(+); Xref=Rhea:RHEA:39935, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30823, ChEBI:CHEBI:52333, ChEBI:CHEBI:75937; Evidence={ECO:0000250|UniProtKB:P54310};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1,3-di-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + (9Z-octadecenoyl)-glycerol + H(+); Xref=Rhea:RHEA:39939, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30823, ChEBI:CHEBI:75735, ChEBI:CHEBI:75937; Evidence={ECO:0000250|UniProtKB:P54310};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1,2-di-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + 2-(9Z-octadecenoyl)-glycerol + H(+); Xref=Rhea:RHEA:38659, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30823, ChEBI:CHEBI:52323, ChEBI:CHEBI:73990; Evidence={ECO:0000250|UniProtKB:P15304};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Retinyl ester hydrolase is inhibited by bis-p-nitrophenyl phosphate.
GENATLAS Biochemistry:
lipase,hormone sensitive with two isoforms expressed in adipose tissue (HSLadi),testis (HSLtes),associated with obesity and non insulin dependent diabetes

Enzyme Numbers (IUBMB) for LIPE Gene

Phenotypes From GWAS Catalog for LIPE Gene

Gene Ontology (GO) - Molecular Function for LIPE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004771 sterol esterase activity IDA 8812477
GO:0004806 triglyceride lipase activity IDA 15716583
GO:0005515 protein binding IPI 17026959
GO:0016298 lipase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with LIPE: view
genes like me logo Genes that share phenotypes with LIPE: view

Human Phenotype Ontology for LIPE Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for LIPE Gene

MGI Knock Outs for LIPE:
  • Lipe Lipe<tm1b(KOMP)Wtsi>
  • Lipe Lipe<tm1Land>
  • Lipe Lipe<tm1Gam>
  • Lipe Lipe<tm1Ishi>
  • Lipe Lipe<tm1Rze>

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for LIPE

No data available for miRNA , Transcription Factor Targets and HOMER Transcription for LIPE Gene

Localization for LIPE Gene

Subcellular locations from UniProtKB/Swiss-Prot for LIPE Gene

Cell membrane. Membrane, caveola. Cytoplasm, cytosol. Lipid droplet. Note=Found in the high-density caveolae. Translocates to the cytoplasm from the caveolae upon insulin stimulation (PubMed:17026959). Phosphorylation by AMPK reduces its translocation towards the lipid droplets (By similarity). {ECO:0000250 UniProtKB:P54310, ECO:0000269 PubMed:17026959}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for LIPE gene
Compartment Confidence
cytosol 5
plasma membrane 4
mitochondrion 3
nucleus 3
extracellular 2
cytoskeleton 2
peroxisome 2
endoplasmic reticulum 2
lysosome 2
endosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for LIPE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005811 lipid droplet ISS --
GO:0005829 cytosol IDA --
GO:0005886 plasma membrane IEA --
GO:0005901 caveola IEA --
genes like me logo Genes that share ontologies with LIPE: view

Pathways & Interactions for LIPE Gene

genes like me logo Genes that share pathways with LIPE: view

Pathways by source for LIPE Gene

3 GeneGo (Thomson Reuters) pathways for LIPE Gene
  • Development Beta-adrenergic receptors signaling via cAMP
  • Regulation of lipid metabolism Insulin signaling-generic cascades
  • Signal transduction cAMP signaling
5 Qiagen pathways for LIPE Gene
  • Activation of cAMP-Dependent PKA
  • Activation of PKA through GPCR
  • AMPK Enzyme Complex Pathway
  • cAMP Pathway
  • PKA Signaling
1 Cell Signaling Technology pathway for LIPE Gene

UniProtKB/Swiss-Prot Q05469-LIPS_HUMAN

  • Pathway: Glycerolipid metabolism; triacylglycerol degradation.

SIGNOR curated interactions for LIPE Gene

Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for LIPE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation TAS 3420405
GO:0006629 lipid metabolic process IEA --
GO:0008202 steroid metabolic process IEA --
GO:0008203 cholesterol metabolic process IEA --
GO:0016042 lipid catabolic process IEA,ISS --
genes like me logo Genes that share ontologies with LIPE: view

Drugs & Compounds for LIPE Gene

(38) Drugs for LIPE Gene - From: DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Glycerol Approved, Investigational Pharma 207
Palmitic Acid Approved Pharma 27
Stearic acid Approved, Experimental Pharma 0
Water Approved Pharma 0
cyclic amp Experimental Pharma 0

(101) Additional Compounds for LIPE Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Arachidic acid
  • Arachic acid
  • Arachidinic acid
  • Arachinsaeure
  • C20:0
  • CH3-[CH2]18-COOH
506-30-9
DG(16:0/24:0/0:0)
  • 1-Palmitoyl-2-lignoceroyl-sn-glycerol
  • DAG(16:0/24:0)
  • DAG(40:0)
  • DG(16:0/24:0)
  • DG(40:0)
Diglycerides Group A
  • (2R)-2-Hydroxy-3-(pentadecanoyloxy)propyl (11Z)-icos-11-enoic acid
  • Diacylglycerol(15:0/0:0/20:1)
  • DAG(35:1)
  • Diacylglycerol(35:1)
  • DG(15:0/0:0/20:1W9)
Diglycerides Group B
  • Diglyceride
  • DG(32:4)
  • DG(14:1/18:3)
  • DAG(14:1/18:3)
  • Diacylglycerol(32:4)
257891-89-7
Diglycerides Group C
  • (2S)-1-Hydroxy-3-(palmitoyloxy)propan-2-yl (5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenoate
  • 1,2-DG 16:0/20:4(omega-6)
  • 1-Hexadecanoyl-2-(5Z,8Z,11Z,14Z)-icosatetraenoyl-sn-glycerol
  • 1-Hexadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycerol
  • DAG(16:0/20:4)
91125-76-7, 29541-66-0, 51621-26-2
genes like me logo Genes that share compounds with LIPE: view

Transcripts for LIPE Gene

mRNA/cDNA for LIPE Gene

1 REFSEQ mRNAs :
6 NCBI additional mRNA sequence :
9 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for LIPE

Alternative Splicing Database (ASD) splice patterns (SP) for LIPE Gene

ExUns: 1 ^ 2 ^ 3a · 3b ^ 4 ^ 5a · 5b ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10a · 10b ^ 11a · 11b · 11c ^ 12 ^ 13a · 13b · 13c ^ 14
SP1: - - -
SP2: -
SP3: -
SP4:
SP5:
SP6: - - - -
SP7:
SP8: - - - -
SP9: - - -
SP10: -

Relevant External Links for LIPE Gene

GeneLoc Exon Structure for
LIPE

Expression for LIPE Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for LIPE Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for LIPE Gene

This gene is overexpressed in Adipose - Subcutaneous (x14.8), Adipose - Visceral (Omentum) (x11.2), and Breast - Mammary Tissue (x7.7).

Protein differential expression in normal tissues from HIPED for LIPE Gene

This gene is overexpressed in Adipocyte (47.7) and Nasopharynx (19.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for LIPE Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for LIPE

SOURCE GeneReport for Unigene cluster for LIPE Gene:

Hs.656980

mRNA Expression by UniProt/SwissProt for LIPE Gene:

Q05469-LIPS_HUMAN
Tissue specificity: Testis.

Evidence on tissue expression from TISSUES for LIPE Gene

  • Nervous system(4)
  • Muscle(2.9)
  • Blood(2.6)
  • Liver(2.6)
  • Adrenal gland(2.6)
  • Heart(2.5)
  • Pancreas(2.5)
  • Intestine(2.3)
  • Skin(2.2)
  • Kidney(2.1)

Phenotype-based relationships between genes and organs from Gene ORGANizer for LIPE Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • cardiovascular
  • digestive
  • immune
  • integumentary
  • reproductive
  • skeletal muscle
  • skeleton
Regions:
Head and neck:
  • ear
  • head
  • jaw
  • mandible
  • maxilla
  • mouth
  • neck
  • skull
Thorax:
  • chest wall
  • clavicle
  • heart
  • rib
  • rib cage
  • scapula
  • sternum
Abdomen:
  • intestine
  • liver
  • pancreas
  • small intestine
Pelvis:
  • ovary
  • pelvis
  • uterus
Limb:
  • ankle
  • arm
  • digit
  • elbow
  • femur
  • fibula
  • finger
  • foot
  • forearm
  • hand
  • hip
  • humerus
  • knee
  • lower limb
  • radius
  • shin
  • shoulder
  • thigh
  • tibia
  • toe
  • ulna
  • upper limb
  • wrist
General:
  • blood
  • blood vessel
  • skin
  • spinal column
  • vertebrae
  • white blood cell
genes like me logo Genes that share expression patterns with LIPE: view

Primer products for research

No data available for Protein tissue co-expression partners for LIPE Gene

Orthologs for LIPE Gene

This gene was present in the common ancestor of animals.

Orthologs for LIPE Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia LIPE 29 30
  • 99.26 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia LIPE 29
  • 86.17 (n)
HSL 30
  • 86 (a)
OneToOne
Dog
(Canis familiaris)
Mammalia LIPE 29
  • 83.98 (n)
HSL 30
  • 80 (a)
OneToOne
Mouse
(Mus musculus)
Mammalia Lipe 29 16 30
  • 81.96 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Lipe 29
  • 78.08 (n)
Oppossum
(Monodelphis domestica)
Mammalia LIPE 30
  • 53 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia LIPE 30
  • 48 (a)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia LIPE 30
  • 65 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia lipe 29
  • 62.34 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.18619 29
Zebrafish
(Danio rerio)
Actinopterygii lipeb 29 30
  • 61.53 (n)
OneToMany
lipea 30
  • 53 (a)
OneToMany
Dr.14982 29
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.13588 29
Fruit Fly
(Drosophila melanogaster)
Insecta CG11055 30 31
  • 28 (a)
OneToOne
Worm
(Caenorhabditis elegans)
Secernentea C46C11.1 31
  • 33 (a)
hosl-1 30
  • 24 (a)
OneToOne
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 30
  • 51 (a)
OneToMany
CSA.8706 30
  • 26 (a)
OneToMany
Species where no ortholog for LIPE was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for LIPE Gene

ENSEMBL:
Gene Tree for LIPE (if available)
TreeFam:
Gene Tree for LIPE (if available)
Aminode:
Evolutionary constrained regions (ECRs) for LIPE: view image
Alliance of Genome Resources:
Additional Orthologs for LIPE

Paralogs for LIPE Gene

No data available for Paralogs for LIPE Gene

Variants for LIPE Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for LIPE Gene

SNP ID Clinical significance and condition Chr 19 pos Variation AA Info Type
1028369 Uncertain Significance: Familial partial lipodystrophy 6 42,408,088(-) C/T
NM_005357.4(LIPE):c.1544G>A (p.Arg515His)
MISSENSE
1028370 Likely Pathogenic: Familial partial lipodystrophy 6 42,406,374(-) G/A
NM_005357.4(LIPE):c.2152C>T (p.Arg718Ter)
NONSENSE
1028371 Pathogenic: Familial partial lipodystrophy 6 42,402,795(-) C/A
NM_005357.4(LIPE):c.2779G>T (p.Glu927Ter)
NONSENSE
1032990 Pathogenic: Familial partial lipodystrophy 6 42,405,475(-) G/A
NM_005357.4(LIPE):c.2452C>T (p.Arg818Ter)
NONSENSE
998371 Uncertain Significance: Familial partial lipodystrophy 6 42,410,813(-) G/A
NM_005357.4(LIPE):c.913C>T (p.Arg305Cys)
MISSENSE

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for LIPE Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for LIPE Gene

Variant ID Type Subtype PubMed ID
dgv6460n54 CNV loss 21841781
esv2422471 CNV deletion 17116639
nsv520239 CNV loss 19592680
nsv522854 CNV gain 19592680
nsv526186 CNV gain 19592680
nsv579632 CNV gain 21841781
nsv579633 CNV loss 21841781
nsv953584 CNV deletion 24416366

Variation tolerance for LIPE Gene

Residual Variation Intolerance Score: 83.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.72; 73.20% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for LIPE Gene

Human Gene Mutation Database (HGMD)
LIPE
SNPedia medical, phenotypic, and genealogical associations of SNPs for
LIPE
Leiden Open Variation Database (LOVD)
LIPE

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for LIPE Gene

Disorders for LIPE Gene

MalaCards: The human disease database

(20) MalaCards diseases for LIPE Gene - From: OMI, CVR, GTR, ORP, COP, and GCD

- elite association - COSMIC cancer census association via MalaCards
Search LIPE in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

LIPS_HUMAN
  • Lipodystrophy, familial partial, 6 (FPLD6) [MIM:615980]: A form of lipodystrophy characterized by abnormal subcutaneous fat distribution. Affected individuals have increased visceral fat, impaired lipolysis, dyslipidemia, hepatic steatosis, systemic insulin resistance, and diabetes. Some patients manifest muscular dystrophy. {ECO:0000269 PubMed:24848981}. Note=The disease is caused by variants affecting the gene represented in this entry.

Additional Disease Information for LIPE

Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform
genes like me logo Genes that share disorders with LIPE: view

No data available for Genatlas for LIPE Gene

Publications for LIPE Gene

  1. Gene organization and primary structure of human hormone-sensitive lipase: possible significance of a sequence homology with a lipase of Moraxella TA144, an antarctic bacterium. (PMID: 8506334) Langin D … Holm C (Proceedings of the National Academy of Sciences of the United States of America 1993) 2 3 4 22
  2. In vitro stereoselective hydrolysis of diacylglycerols by hormone-sensitive lipase. (PMID: 19800417) Rodriguez JA … Abousalham A (Biochimica et biophysica acta 2010) 3 4 22
  3. Association of lifestyle factors, polymorphisms in adiponectin, perilipin and hormone sensitive lipase, and clinical markers in Japanese males. (PMID: 20495294) Sone Y … Otsuka Y (Journal of nutritional science and vitaminology 2010) 3 22 40
  4. Blunted beta-adrenoceptor-mediated fat oxidation in overweight subjects: a role for the hormone-sensitive lipase gene. (PMID: 18249203) Jocken JW … Saris WH (Metabolism: clinical and experimental 2008) 3 22 40
  5. The combination of ApoCIII, hepatic lipase and hormono sensitive lipase gene polymorphisms suggests an association with susceptibility to gestational hypertension. (PMID: 17318300) Bernard N … Giguère Y (Journal of human genetics 2007) 3 22 40

Products for LIPE Gene