There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a un... See more...

Aliases for LIMK1 Gene

Aliases for LIMK1 Gene

  • LIM Domain Kinase 1 2 3 4 5
  • EC 2.7.11.1 4 52
  • LIMK-1 3 4
  • LIMK 3 4
  • LIM Motif-Containing Protein Kinase 3

External Ids for LIMK1 Gene

Previous GeneCards Identifiers for LIMK1 Gene

  • GC07P072138
  • GC07P072896
  • GC07P072910
  • GC07P072942
  • GC07P073136
  • GC07P073497
  • GC07P069382

Summaries for LIMK1 Gene

Entrez Gene Summary for LIMK1 Gene

  • There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is a serine/threonine kinase that regulates actin polymerization via phosphorylation and inactivation of the actin binding factor cofilin. This protein is ubiquitously expressed during development and plays a role in many cellular processes associated with cytoskeletal structure. This protein also stimulates axon growth and may play a role in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Feb 2011]

GeneCards Summary for LIMK1 Gene

LIMK1 (LIM Domain Kinase 1) is a Protein Coding gene. Diseases associated with LIMK1 include Williams-Beuren Syndrome and Supravalvular Aortic Stenosis. Among its related pathways are Human cytomegalovirus infection and EPH-Ephrin signaling. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is LIMK2.

UniProtKB/Swiss-Prot Summary for LIMK1 Gene

  • Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways (PubMed:10436159, PubMed:11832213, PubMed:12807904, PubMed:15660133, PubMed:16230460, PubMed:18028908, PubMed:22328514, PubMed:23633677). Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop (PubMed:10436159). LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin-2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton (PubMed:11832213, PubMed:15660133, PubMed:16230460, PubMed:23633677). In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation (PubMed:11832213, PubMed:15660133, PubMed:16230460, PubMed:23633677). Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly (PubMed:18028908). Stimulates axonal outgrowth and may be involved in brain development (PubMed:18028908).
  • [Isoform 3]: Has a dominant negative effect on actin cytoskeletal changes. Required for atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1).

Tocris Summary for LIMK1 Gene

  • LIM kinases (LIMKs), EC 2.7.11.1, are dual specificity kinases (serine/threonine and tyrosine), which phosphorylate and inactivate cofilin (a key regulator of actin cytoskeleton dynamics). There are two isoforms of LIMK: LIMK1 and LIMK2.

Gene Wiki entry for LIMK1 Gene

Additional gene information for LIMK1 Gene

No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for LIMK1 Gene

Genomics for LIMK1 Gene

GeneHancer (GH) Regulatory Elements for LIMK1 Gene

Promoters and enhancers for LIMK1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH07J074096 Promoter/Enhancer 1.7 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 534.5 +16.5 16467 5.6 JUND FOS ZNF639 REST RELA CTBP1 BCL11A TCF12 CBFB SRF LIMK1 AB372643-010 ELN-AS1 ELN RF00017-6326
GH07J074082 Promoter/Enhancer 1.6 Ensembl ENCODE CraniofacialAtlas 534.7 +1.4 1378 3.1 EP300 POLR2G JUND FOS REST ZBTB11 ZBTB26 TGIF2 CTBP1 JUN LIMK1 ELN-AS1 AB372643-010 RF00017-6326
GH07J074081 Enhancer 0.3 Ensembl 500.7 -1.0 -1032 0.2 PRDM10 ZNF770 LIMK1 RF00017-6327 RF00017-6326
GH07J074091 Promoter/Enhancer 1.5 Ensembl ENCODE CraniofacialAtlas dbSUPER 33.2 +10.9 10890 4.3 ZBTB40 ZSCAN5C TCF12 JUND TEAD4 FOS ZIC2 REST ZNF623 POLR2A LIMK1 ELN-AS1 ELN AB372643-010 RF00017-6326
GH07J074171 Promoter/Enhancer 2 EPDnew Ensembl ENCODE CraniofacialAtlas 21.6 +91.9 91915 6 HNRNPK EP300 SIN3A NRF1 MYC POLR2G USF1 SP1 GTF2E2 PHF8 EIF4H lnc-RFC2-4 LIMK1 LAT2 RF00017-6329 MIR590
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around LIMK1 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for LIMK1

Top Transcription factor binding sites by QIAGEN in the LIMK1 gene promoter:
  • CREB
  • deltaCREB
  • SRF
  • SRF (504 AA)
  • STAT3

Genomic Locations for LIMK1 Gene

Genomic Locations for LIMK1 Gene
chr7:74,082,933-74,122,525
(GRCh38/hg38)
Size:
39,593 bases
Orientation:
Plus strand
chr7:73,497,263-73,536,855
(GRCh37/hg19)
Size:
39,593 bases
Orientation:
Plus strand

Genomic View for LIMK1 Gene

Genes around LIMK1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
LIMK1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for LIMK1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for LIMK1 Gene

Proteins for LIMK1 Gene

  • Protein details for LIMK1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P53667-LIMK1_HUMAN
    Recommended name:
    LIM domain kinase 1
    Protein Accession:
    P53667
    Secondary Accessions:
    • B7Z6I8
    • D3DXF4
    • D3DXF5
    • O15283
    • Q15820
    • Q15821
    • Q75MU3
    • Q9Y5Q1

    Protein attributes for LIMK1 Gene

    Size:
    647 amino acids
    Molecular mass:
    72585 Da
    Quaternary structure:
    • Interacts (via LIM domain) with the cytoplasmic domain of NRG1. Interacts with NISCH. Interacts with RLIM and RNF6 (By similarity). Self-associates to form homodimers (PubMed:10196227). Interacts with HSP90AA1; this interaction promotes LIMK1 dimerization and subsequent transphosphorylation (PubMed:16641196). Interacts with CDKN1C (PubMed:14530263). Interacts with SSH1 (PubMed:15660133). Interacts with ROCK1 (PubMed:10436159, PubMed:10652353). Interacts (via LIM zinc-binding domains) with FAM89B/LRAP25 (via LRR repeat). Forms a tripartite complex with CDC42BPA, CDC42BPB and FAM89B/LRAP25 (By similarity).
    Miscellaneous:
    • [Isoform 3]: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Three dimensional structures from OCA and Proteopedia for LIMK1 Gene

    Alternative splice isoforms for LIMK1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for LIMK1 Gene

Selected DME Specific Peptides for LIMK1 Gene

P53667:
  • RYTVVGNPYWMAPEM
  • GCFGQAIKVTHR
  • YPWSQRVSFAKDIA
  • VVTPVIEQILPDSPGS
  • HRIFRPSDLI
  • VNADPDYLPRTMDFGLNVR
  • PHTVTLVS
  • HPNVLKFIGVLYK
  • VLKFIGVLYKDK
  • ITKGLVMV
  • GRSESLRVV
  • FIGDGDTY
  • GMAYLHSM
  • DGQYLQALNADWHADCFRC
  • CCDLDPEKRP
  • FSFGIVLCEIIG
  • IIHRDLN
  • TEYIKGG
  • GKRGLSVSI
  • CKKDYWAR
  • DRILEING
  • LIQETSRLLQLT
  • LLCCTWR
  • KYHPECF
  • TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHP
  • CPPSFFPI

Post-translational modifications for LIMK1 Gene

  • Autophosphorylated. Phosphorylated on Thr-508 by ROCK1 and PAK1, resulting in activation. Phosphorylated by PAK4 which increases the ability of LIMK1 to phosphorylate cofilin. Phosphorylated at Ser-323 by MAPKAPK2 during activation of VEGFA-induced signaling, which results in activation of LIMK1 and promotion of actin reorganization, cell migration, and tubule formation of endothelial cells. Dephosphorylated and inactivated by SSH1. Phosphorylated by CDC42BP.
  • Ubiquitinated. 'Lys-48'-linked polyubiquitination by RNF6 leads to proteasomal degradation through the 26S proteasome, modulating LIMK1 levels in the growth cone and its effect on axonal outgrowth. Also polyubiquitinated by RLIM (By similarity).
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for LIMK1 Gene

Antibody Products

  • Boster Bio Antibodies for LIMK1

Domains & Families for LIMK1 Gene

Gene Families for LIMK1 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Disease related genes
  • Enzymes
  • Plasma proteins
  • Potential drug targets
  • Predicted intracellular proteins

Protein Domains for LIMK1 Gene

Blocks:
  • Zn-binding protein, LIM
  • PDZ/DHR/GLGF domain
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for LIMK1 Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ55661, highly similar to LIM domain kinase 1 (EC 2.7.11.1) (B7Z6I8_HUMAN)
  • LIM domain kinase 1 (LIMK1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P53667

UniProtKB/Swiss-Prot:

LIMK1_HUMAN :
  • Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
Family:
  • Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
genes like me logo Genes that share domains with LIMK1: view

Function for LIMK1 Gene

Molecular function for LIMK1 Gene

UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways (PubMed:10436159, PubMed:11832213, PubMed:12807904, PubMed:15660133, PubMed:16230460, PubMed:18028908, PubMed:22328514, PubMed:23633677). Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop (PubMed:10436159). LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin-2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton (PubMed:11832213, PubMed:15660133, PubMed:16230460, PubMed:23633677). In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation (PubMed:11832213, PubMed:15660133, PubMed:16230460, PubMed:23633677). Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly (PubMed:18028908). Stimulates axonal outgrowth and may be involved in brain development (PubMed:18028908).
UniProtKB/Swiss-Prot Function:
[Isoform 3]: Has a dominant negative effect on actin cytoskeletal changes. Required for atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:17990; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence=. ; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:46609; Evidence=. ;.
GENATLAS Biochemistry:
LIM motif containing protein kinase 1,serine only protein kinase,cytosolic,highly expressed in neurons,regulating actin dynamics through phosphorylation of cofilin,which leads to accumulation of F-actin,deleted in Williams syndrome,claimed to be responsible for the cognitive defect of the syndrome,but contradictory evidence,see WBS1

Enzyme Numbers (IUBMB) for LIMK1 Gene

Phenotypes From GWAS Catalog for LIMK1 Gene

Gene Ontology (GO) - Molecular Function for LIMK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity NAS 8537403
GO:0004674 protein serine/threonine kinase activity TAS --
GO:0005515 protein binding IEA,IPI 8940095
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
genes like me logo Genes that share ontologies with LIMK1: view
genes like me logo Genes that share phenotypes with LIMK1: view

Human Phenotype Ontology for LIMK1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for LIMK1 Gene

MGI Knock Outs for LIMK1:

Animal Model Products

  • Taconic Biosciences Mouse Models for LIMK1

miRNA for LIMK1 Gene

Clone Products

  • Addgene plasmids for LIMK1

No data available for Transcription Factor Targets and HOMER Transcription for LIMK1 Gene

Localization for LIMK1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for LIMK1 Gene

Cytoplasm. Nucleus. Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Note=Predominantly found in the cytoplasm. Localizes in the lamellipodium in a CDC42BPA, CDC42BPB and FAM89B/LRAP25-dependent manner. {ECO:0000250 UniProtKB:P53668}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for LIMK1 gene
Compartment Confidence
nucleus 5
cytosol 5
cytoskeleton 3
plasma membrane 2
extracellular 2
mitochondrion 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Nuclear speckles (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for LIMK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IBA 21873635
GO:0005737 cytoplasm IBA,IDA 17512523
GO:0005829 cytosol TAS --
GO:0005925 focal adhesion IEA --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with LIMK1: view

Pathways & Interactions for LIMK1 Gene

PathCards logo

SuperPathways for LIMK1 Gene

SuperPathway Contained pathways
1 Semaphorin interactions
2 Actin Nucleation by ARP-WASP Complex
.66
.41
.35
3 EPH-Ephrin signaling
.35
4 Cytoskeleton remodeling Regulation of actin cytoskeleton by Rho GTPases
.49
.49
.42
5 G-protein signaling RAC1 in cellular process
.37
genes like me logo Genes that share pathways with LIMK1: view

Pathways by source for LIMK1 Gene

10 GeneGo (Thomson Reuters) pathways for LIMK1 Gene
  • Cell adhesion Integrin-mediated cell adhesion and migration
  • Cytoskeleton remodeling CDC42 in cellular processes
  • Cytoskeleton remodeling Fibronectin-binding integrins in cell motility
  • Cytoskeleton remodeling Regulation of actin cytoskeleton by Rho GTPases
  • Cytoskeleton remodeling Role of PKA in cytoskeleton reorganisation
14 Qiagen pathways for LIMK1 Gene
  • Actin Nucleation and Branching
  • Actin-Based Motility by Rho Family GTPases
  • Breast Cancer Regulation by Stathmin1
  • CCR3 Pathway in Eosinophils
  • CDC42 Pathway
1 Cell Signaling Technology pathway for LIMK1 Gene

SIGNOR curated interactions for LIMK1 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for LIMK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IMP,IDA 23633677
GO:0007165 signal transduction TAS 10428028
GO:0007266 Rho protein signal transduction TAS 10436159
GO:0007399 nervous system development TAS 8689688
GO:0016310 phosphorylation IEA --
genes like me logo Genes that share ontologies with LIMK1: view

Drugs & Compounds for LIMK1 Gene

(9) Drugs for LIMK1 Gene - From: DrugBank, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Dabrafenib Approved, Investigational Pharma Target, antagonist, inhibitor BRAF kinase inhibitor, Kinase Inhibitors, Mutant BRAF Kinase 109
fostamatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors 0
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0
LIMKi 3 Pharma LIMK2 inhibitor, Potent LIM kinase inhibitor; antitumor 0

(4) Additional Compounds for LIMK1 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor 58-64-0
SR 7826
1219728-20-7
T 5601640
924473-59-6

(3) Tocris Compounds for LIMK1 Gene

Compound Action Cas Number
LIMKi 3 Potent LIM kinase inhibitor; antitumor 1338247-35-0
SR 7826 Potent and selective LIMK inhibitor; antitumor 1219728-20-7
T 5601640 Selective LIMK2 inhibitor; antitumor 924473-59-6
genes like me logo Genes that share compounds with LIMK1: view

Transcripts for LIMK1 Gene

mRNA/cDNA for LIMK1 Gene

3 REFSEQ mRNAs :
9 NCBI additional mRNA sequence :
8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Clone Products

  • Addgene plasmids for LIMK1

Alternative Splicing Database (ASD) splice patterns (SP) for LIMK1 Gene

ExUns: 1 ^ 2a · 2b ^ 3 ^ 4 ^ 5a · 5b · 5c ^ 6 ^ 7a · 7b ^ 8 ^ 9a · 9b ^ 10 ^ 11a · 11b · 11c ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16a · 16b ^ 17a ·
SP1: - - - - - - -
SP2: - - - - - - - -
SP3:
SP4: - - -
SP5: - - - - - -
SP6: -
SP7:
SP8: -
SP9:

ExUns: 17b ^ 18a · 18b ^ 19a · 19b · 19c
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:

Relevant External Links for LIMK1 Gene

GeneLoc Exon Structure for
LIMK1

Expression for LIMK1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for LIMK1 Gene

mRNA differential expression in normal tissues according to GTEx for LIMK1 Gene

This gene is overexpressed in Brain - Cortex (x4.2).

Protein differential expression in normal tissues from HIPED for LIMK1 Gene

This gene is overexpressed in Frontal cortex (26.0), Testis (14.9), Spinal cord (14.1), and Ovary (6.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for LIMK1 Gene



Protein tissue co-expression partners for LIMK1 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for LIMK1

SOURCE GeneReport for Unigene cluster for LIMK1 Gene:

Hs.647035

mRNA Expression by UniProt/SwissProt for LIMK1 Gene:

P53667-LIMK1_HUMAN
Tissue specificity: Highest expression in both adult and fetal nervous system. Detected ubiquitously throughout the different regions of adult brain, with highest levels in the cerebral cortex. Expressed to a lesser extent in heart and skeletal muscle.

Evidence on tissue expression from TISSUES for LIMK1 Gene

  • Nervous system(4.9)
  • Muscle(2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for LIMK1 Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • cardiovascular
  • digestive
  • endocrine
  • immune
  • integumentary
  • nervous
  • reproductive
  • respiratory
  • skeletal muscle
  • skeleton
  • urinary
Regions:
Head and neck:
  • brain
  • cerebellum
  • cheek
  • chin
  • cranial nerve
  • ear
  • eye
  • eyelid
  • face
  • forehead
  • head
  • jaw
  • larynx
  • lip
  • mandible
  • maxilla
  • middle ear
  • mouth
  • neck
  • nose
  • outer ear
  • skull
  • tongue
  • tooth
  • vocal cord
Thorax:
  • aorta
  • chest wall
  • clavicle
  • esophagus
  • heart
  • heart valve
  • lung
  • rib
  • rib cage
  • scapula
  • sternum
Abdomen:
  • duodenum
  • intestine
  • kidney
  • large intestine
  • pancreas
  • small intestine
  • stomach
Pelvis:
  • anus
  • pelvis
  • rectum
  • ureter
  • urethra
  • urinary bladder
Limb:
  • ankle
  • arm
  • digit
  • elbow
  • femur
  • fibula
  • finger
  • foot
  • forearm
  • hand
  • hip
  • humerus
  • knee
  • lower limb
  • nail
  • radius
  • shin
  • shoulder
  • thigh
  • tibia
  • toe
  • ulna
  • upper limb
  • wrist
General:
  • blood
  • blood vessel
  • coagulation system
  • hair
  • peripheral nerve
  • peripheral nervous system
  • skin
  • spinal column
  • spinal cord
  • vertebrae
  • white blood cell
genes like me logo Genes that share expression patterns with LIMK1: view

Orthologs for LIMK1 Gene

This gene was present in the common ancestor of animals.

Orthologs for LIMK1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia LIMK1 31 30
  • 99.64 (n)
OneToOne
cow
(Bos Taurus)
Mammalia LIMK1 31 30
  • 92.12 (n)
OneToOne
dog
(Canis familiaris)
Mammalia LIMK1 31 30
  • 90.01 (n)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia LIMK1 31
  • 90 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Limk1 17 31 30
  • 88 (n)
rat
(Rattus norvegicus)
Mammalia Limk1 30
  • 88 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia LIMK1 31
  • 78 (a)
OneToOne
chicken
(Gallus gallus)
Aves LIMK1 31 30
  • 82.04 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia LIMK1 31
  • 83 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia limk1 30
  • 69.65 (n)
African clawed frog
(Xenopus laevis)
Amphibia xlimk1 30
zebrafish
(Danio rerio)
Actinopterygii limk1a 31 30
  • 71.62 (n)
OneToMany
limk1b 31
  • 56 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta LIMK1 31 30
  • 56.67 (n)
OneToMany
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP011710 30
  • 32.92 (n)
worm
(Caenorhabditis elegans)
Secernentea K09B11.5 31
  • 19 (a)
ManyToMany
kin-21 31
  • 19 (a)
ManyToMany
Y52D5A.2 31
  • 18 (a)
ManyToMany
Y69E1A.3 31
  • 17 (a)
ManyToMany
T25B9.5 31
  • 17 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 41 (a)
OneToMany
Species where no ortholog for LIMK1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for LIMK1 Gene

ENSEMBL:
Gene Tree for LIMK1 (if available)
TreeFam:
Gene Tree for LIMK1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for LIMK1: view image

Paralogs for LIMK1 Gene

(16) SIMAP similar genes for LIMK1 Gene using alignment to 4 proteins:

  • LIMK1_HUMAN
  • E9PC47_HUMAN
  • Q75MU0_HUMAN
  • Q75MU4_HUMAN

Pseudogenes.org Pseudogenes for LIMK1 Gene

genes like me logo Genes that share paralogs with LIMK1: view

Variants for LIMK1 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for LIMK1 Gene

SNP ID Clinical significance and condition Chr 07 pos Variation AA Info Type
707978 Likely Benign: not provided 74,106,071(+) C/A INTRON_VARIANT
709429 Benign: not provided 74,097,072(+) C/G INTRON_VARIANT
709787 Likely Benign: not provided 74,120,577(+) A/T INTRON_VARIANT
711707 Benign: not provided 74,109,017(+) G/A MISSENSE_VARIANT
711985 Likely Benign: not provided 74,107,139(+) G/A SYNONYMOUS_VARIANT

Additional dbSNP identifiers (rs#s) for LIMK1 Gene

Structural Variations from Database of Genomic Variants (DGV) for LIMK1 Gene

Variant ID Type Subtype PubMed ID
esv1010108 CNV deletion 20482838
esv1038833 CNV deletion 17803354
esv3613697 CNV loss 21293372
esv3613698 CNV loss 21293372
nsv366821 CNV deletion 16902084
nsv464563 CNV gain 19166990
nsv607479 CNV loss 21841781
nsv607480 CNV gain 21841781
nsv831030 CNV gain 17160897

Variation tolerance for LIMK1 Gene

Residual Variation Intolerance Score: 15.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.88; 48.47% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for LIMK1 Gene

Human Gene Mutation Database (HGMD)
LIMK1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
LIMK1

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for LIMK1 Gene

Disorders for LIMK1 Gene

MalaCards: The human disease database

(8) MalaCards diseases for LIMK1 Gene - From: Orphanet, DISEASES, Novoseek, and GeneCards

- elite association - COSMIC cancer census association via MalaCards
Search LIMK1 in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

LIMK1_HUMAN
  • Note=LIMK1 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.

Additional Disease Information for LIMK1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with LIMK1: view

No data available for Genatlas for LIMK1 Gene

Publications for LIMK1 Gene

  1. Identification of genes from a 500-kb region at 7q11.23 that is commonly deleted in Williams syndrome patients. (PMID: 8812460) Osborne LR … Tsui LC (Genomics 1996) 2 3 4 23 54
  2. Genetic factors for ischemic and hemorrhagic stroke in Japanese individuals. (PMID: 18566305) Yamada Y … Nozawa Y (Stroke 2008) 3 23 41 54
  3. MAPKAPK-2-mediated LIM-kinase activation is critical for VEGF-induced actin remodeling and cell migration. (PMID: 16456544) Kobayashi M … Mizuno K (The EMBO journal 2006) 3 4 23 54
  4. A haplotype spanning two genes, ELN and LIMK1, decreases their transcripts and confers susceptibility to intracranial aneurysms. (PMID: 16611674) Akagawa H … Inoue I (Human molecular genetics 2006) 3 23 41 54
  5. Interplay between components of a novel LIM kinase-slingshot phosphatase complex regulates cofilin. (PMID: 15660133) Soosairajah J … Bernard O (The EMBO journal 2005) 3 4 23 54

Products for LIMK1 Gene

  • Addgene plasmids for LIMK1

Sources for LIMK1 Gene