Free for academic non-profit institutions. Other users need a Commercial license

Aliases for INPP4B Gene

Aliases for INPP4B Gene

  • Inositol Polyphosphate-4-Phosphatase Type II B 2 3 5
  • EC 3.1.3.66 4 56
  • Inositol Polyphosphate-4-Phosphatase, Type II, 105kDa 2
  • Inositol Polyphosphate-4-Phosphatase, Type II, 105kD 2
  • Inositol Polyphosphate 4-Phosphatase Type II 4

External Ids for INPP4B Gene

Previous GeneCards Identifiers for INPP4B Gene

  • GC04M143812
  • GC04M143266
  • GC04M143415
  • GC04M143527
  • GC04M143526
  • GC04M143306
  • GC04M142949
  • GC04M138678

Summaries for INPP4B Gene

Entrez Gene Summary for INPP4B Gene

  • INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme. [provided by RefSeq, Jul 2008]

GeneCards Summary for INPP4B Gene

INPP4B (Inositol Polyphosphate-4-Phosphatase Type II B) is a Protein Coding gene. Diseases associated with INPP4B include Vulva Adenocarcinoma. Among its related pathways are Metabolism and Inositol phosphate metabolism (REACTOME). Gene Ontology (GO) annotations related to this gene include lipid binding and phosphatidylinositol trisphosphate phosphatase activity. An important paralog of this gene is INPP4A.

UniProtKB/Swiss-Prot for INPP4B Gene

  • Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate.

Additional gene information for INPP4B Gene

No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for INPP4B Gene

Genomics for INPP4B Gene

GeneHancer (GH) Regulatory Elements for INPP4B Gene

Promoters and enhancers for INPP4B Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH04I142845 Promoter/Enhancer 1.7 EPDnew Ensembl ENCODE 550.8 +1.1 1110 2.4 CTCF MXI1 SUZ12 BACH1 SIN3A RAD21 ZNF335 E2F1 GLIS2 ZNF143 INPP4B LOC105377457
GH04I142473 Promoter/Enhancer 1.5 EPDnew Ensembl ENCODE 550.1 +373.0 372985 2.6 PKNOX1 CLOCK NFIB NEUROD1 SIN3A RFX5 FOS RCOR1 CEBPB REST INPP4B GC04M142451 ENSG00000251248
GH04I142462 Promoter 0.5 EPDnew 550 +384.7 384688 0.1 INPP4B GC04M142451 GC04P142399
GH04I142400 Promoter/Enhancer 2 FANTOM5 Ensembl ENCODE dbSUPER 13.9 +442.3 442253 9.3 FOXA2 BMI1 FEZF1 ZNF2 ZNF335 ZNF366 ATF7 ETV6 FOS IKZF2 INPP4B GC04P142399 GC04M142451
GH04I142350 Enhancer 1 Ensembl ENCODE dbSUPER 11.8 +494.0 494004 6.8 CTCF ZNF654 TRIM22 ELF1 RAD21 JUND GATA3 TARDBP ESR1 SMC3 INPP4B GC04P142318 GC04P142399
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around INPP4B on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the INPP4B gene promoter:

Genomic Locations for INPP4B Gene

Genomic Locations for INPP4B Gene
chr4:142,023,160-142,847,432
(GRCh38/hg38)
Size:
824,273 bases
Orientation:
Minus strand
chr4:142,944,313-143,768,585
(GRCh37/hg19)

Genomic View for INPP4B Gene

Genes around INPP4B on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
INPP4B Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for INPP4B Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for INPP4B Gene

Proteins for INPP4B Gene

  • Protein details for INPP4B Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O15327-INP4B_HUMAN
    Recommended name:
    Type II inositol 3,4-bisphosphate 4-phosphatase
    Protein Accession:
    O15327
    Secondary Accessions:
    • Q2TAI2
    • Q5XLE7
    • Q6IN59
    • Q6PJB4

    Protein attributes for INPP4B Gene

    Size:
    924 amino acids
    Molecular mass:
    104738 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAH72447.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence.; Evidence={ECO:0000305};

    Alternative splice isoforms for INPP4B Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for INPP4B Gene

Selected DME Specific Peptides for INPP4B Gene

O15327:
  • IKLTVYDVKDK
  • INQLQPL
  • PNEPQLEFILAC
  • LSLRTSDGGKVVGTIEVS
  • YRPPEGTYGK
  • MSVTLEQC
  • SVIHPVEQ
  • SASQHSPDSL
  • SHPREDWYEQL
  • DPLFLTGVTFP
  • ASFKVGELLKSKEQLL
  • NLHLQRMQVHSPHLKDALYDVITVGAPAAHFQGFKNGGLR
  • IFMEKMPPDYISHFQEQ
  • YAFNMLQLMAFPK
  • ATHADLLL
  • VDKLIERD
  • SNDVLPV
  • LTRYSSTEIVEGT
  • YPIYEET
  • PVLFNVGINEQQTLAERFGD
  • CKSAKDRT
  • VKMGEIEDG
  • TGRREHYVVEVKLPA
  • CGFIIKL

Post-translational modifications for INPP4B Gene

No Post-translational modifications

Domains & Families for INPP4B Gene

Gene Families for INPP4B Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for INPP4B Gene

Suggested Antigen Peptide Sequences for INPP4B Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

O15327

UniProtKB/Swiss-Prot:

INP4B_HUMAN :
  • Belongs to the inositol 3,4-bisphosphate 4-phosphatase family.
Family:
  • Belongs to the inositol 3,4-bisphosphate 4-phosphatase family.
genes like me logo Genes that share domains with INPP4B: view

Function for INPP4B Gene

Molecular function for INPP4B Gene

UniProtKB/Swiss-Prot CatalyticActivity:
1-phosphatidyl-myo-inositol 3,4-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 3-phosphate + phosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Strongly inhibited by inositol hexakisphosphate.
UniProtKB/Swiss-Prot Function:
Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate.

Enzyme Numbers (IUBMB) for INPP4B Gene

Phenotypes From GWAS Catalog for INPP4B Gene

Gene Ontology (GO) - Molecular Function for INPP4B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 24407287
GO:0016316 phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity TAS --
GO:0016787 hydrolase activity IEA --
GO:0017161 inositol-1,3,4-trisphosphate 4-phosphatase activity TAS --
GO:0034597 phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity IEA --
genes like me logo Genes that share ontologies with INPP4B: view
genes like me logo Genes that share phenotypes with INPP4B: view

Animal Models for INPP4B Gene

MGI Knock Outs for INPP4B:

miRNA for INPP4B Gene

miRTarBase miRNAs that target INPP4B

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for INPP4B Gene

Localization for INPP4B Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for INPP4B gene
Compartment Confidence
cytosol 5
cytoskeleton 3
nucleus 2
plasma membrane 1
extracellular 1
mitochondrion 1
peroxisome 1
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for INPP4B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IBA --
GO:0005829 cytosol TAS --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with INPP4B: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for INPP4B Gene

Pathways & Interactions for INPP4B Gene

genes like me logo Genes that share pathways with INPP4B: view

Pathways by source for INPP4B Gene

UniProtKB/Swiss-Prot O15327-INP4B_HUMAN

  • Pathway: Signal transduction; phosphatidylinositol signaling pathway.

Interacting Proteins for INPP4B Gene

Gene Ontology (GO) - Biological Process for INPP4B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006661 phosphatidylinositol biosynthetic process TAS --
GO:0007165 signal transduction TAS 9295334
GO:0016311 dephosphorylation IEA --
GO:0036092 phosphatidylinositol-3-phosphate biosynthetic process IEA --
GO:0043647 inositol phosphate metabolic process TAS --
genes like me logo Genes that share ontologies with INPP4B: view

No data available for SIGNOR curated interactions for INPP4B Gene

Drugs & Compounds for INPP4B Gene

(2) Drugs for INPP4B Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0

(5) Additional Compounds for INPP4B Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
1D-Myo-inositol 3,4-bisphosphate
  • 1D-Myo-inositol 3,4-bis(dihydrogen phosphate)
  • D-Myo-Inositol 3,4-bisphosphate
  • Inositol 3,4-bisphosphate
69256-53-7
1D-myo-Inositol 3-phosphate
  • 1D-Myo-Inositol 3-monophosphate
  • 1L-Myo-Inositol 1-phosphate
  • D-Myo-Inositol 3-monophosphate
  • D-Myo-Inositol 3-phosphate
  • Inositol 3-monophosphate
2831-74-5
1-Phosphatidyl-1D-myo-inositol 3-phosphate
  • 1-Phosphatidyl-1D-myo-inositol 3-phosphate
  • Phosphatidylinositol 3-phosphate
Myo-inositol 1-phosphate
  • 1-(Dihydrogen phosphate) DL-myo-Inositol
  • 1-(Dihydrogen phosphate) myo-Inositol
  • DL-myo-Inositol 1-phosphate
  • Myo-Inositol 1-monophosphate
  • Myo-Inositol 1-phosphate
573-35-3
Phosphate
  • NFB Orthophosphate
  • O-Phosphoric acid
  • Ortho-phosphate
  • Orthophosphate (PO43-)
  • Orthophosphate(3-)
14265-44-2
genes like me logo Genes that share compounds with INPP4B: view

Transcripts for INPP4B Gene

Unigene Clusters for INPP4B Gene

Inositol polyphosphate-4-phosphatase, type II, 105kDa:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for INPP4B Gene

No ASD Table

Relevant External Links for INPP4B Gene

GeneLoc Exon Structure for
INPP4B
ECgene alternative splicing isoforms for
INPP4B

Expression for INPP4B Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for INPP4B Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for INPP4B Gene

This gene is overexpressed in Peripheral blood mononuclear cells (13.1), Bone (10.7), Lung (8.9), and Breast (8.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for INPP4B Gene



Protein tissue co-expression partners for INPP4B Gene

NURSA nuclear receptor signaling pathways regulating expression of INPP4B Gene:

INPP4B

SOURCE GeneReport for Unigene cluster for INPP4B Gene:

Hs.531403

mRNA Expression by UniProt/SwissProt for INPP4B Gene:

O15327-INP4B_HUMAN
Tissue specificity: Widely expressed with highest levels occurring in the skeletal muscle and heart.

Evidence on tissue expression from TISSUES for INPP4B Gene

  • Nervous system(4.3)
  • Skin(4.2)
genes like me logo Genes that share expression patterns with INPP4B: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for INPP4B Gene

Orthologs for INPP4B Gene

This gene was present in the common ancestor of animals.

Orthologs for INPP4B Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia INPP4B 33 34
  • 99.6 (n)
cow
(Bos Taurus)
Mammalia INPP4B 33 34
  • 91.41 (n)
dog
(Canis familiaris)
Mammalia INPP4B 33 34
  • 87.48 (n)
mouse
(Mus musculus)
Mammalia Inpp4b 33 16 34
  • 86.83 (n)
rat
(Rattus norvegicus)
Mammalia Inpp4b 33
  • 85.61 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia INPP4B 34
  • 78 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia INPP4B 34
  • 75 (a)
OneToOne
chicken
(Gallus gallus)
Aves INPP4B 33 34
  • 79.16 (n)
lizard
(Anolis carolinensis)
Reptilia INPP4B 34
  • 69 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia inpp4b 33
  • 72.52 (n)
zebrafish
(Danio rerio)
Actinopterygii inpp4b 33 34
  • 62.31 (n)
Dr.22355 33
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.2969 33
fruit fly
(Drosophila melanogaster)
Insecta CG1846 35
  • 35 (a)
CG42271 34
  • 21 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea R01H10.7 34
  • 24 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 38 (a)
OneToMany
Species where no ortholog for INPP4B was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for INPP4B Gene

ENSEMBL:
Gene Tree for INPP4B (if available)
TreeFam:
Gene Tree for INPP4B (if available)

Paralogs for INPP4B Gene

Paralogs for INPP4B Gene

genes like me logo Genes that share paralogs with INPP4B: view

Variants for INPP4B Gene

Sequence variations from dbSNP and Humsavar for INPP4B Gene

SNP ID Clin Chr 04 pos Variation AA Info Type
rs1000004419 -- 142,476,282(-) T/C genic_upstream_transcript_variant, intron_variant
rs1000005831 -- 142,474,275(-) G/A genic_upstream_transcript_variant, intron_variant
rs1000006195 -- 142,794,358(-) G/C genic_upstream_transcript_variant, intron_variant
rs1000009258 -- 142,776,935(-) T/A genic_upstream_transcript_variant, intron_variant
rs1000009288 -- 142,428,454(-) A/T genic_upstream_transcript_variant, intron_variant

Structural Variations from Database of Genomic Variants (DGV) for INPP4B Gene

Variant ID Type Subtype PubMed ID
esv1151116 CNV deletion 17803354
esv1561602 CNV deletion 17803354
esv21478 CNV loss 19812545
esv2256713 CNV deletion 18987734
esv2279055 CNV deletion 18987734
esv2659841 CNV deletion 23128226
esv2674465 CNV deletion 23128226
esv2675652 CNV deletion 23128226
esv2677141 CNV deletion 23128226
esv2728453 CNV deletion 23290073
esv2728454 CNV deletion 23290073
esv2728455 CNV deletion 23290073
esv2728456 CNV deletion 23290073
esv2728457 CNV deletion 23290073
esv2728459 CNV deletion 23290073
esv2728461 CNV deletion 23290073
esv2728463 CNV deletion 23290073
esv2728464 CNV deletion 23290073
esv2728465 CNV deletion 23290073
esv2728466 CNV deletion 23290073
esv2728467 CNV deletion 23290073
esv2728468 CNV deletion 23290073
esv2728469 CNV deletion 23290073
esv2728470 CNV deletion 23290073
esv2762467 CNV loss 21179565
esv3058892 CNV deletion 24192839
esv3389600 CNV insertion 20981092
esv3396063 CNV duplication 20981092
esv3434346 CNV insertion 20981092
esv3564742 CNV deletion 23714750
esv3602477 CNV loss 21293372
esv3602479 CNV loss 21293372
esv1010249 CNV deletion 20482838
dgv850e201 CNV deletion 23290073
dgv3089e59 CNV tandem duplication 20981092
dgv1031e214 CNV loss 21293372
esv3602484 CNV loss 21293372
esv3602485 CNV gain 21293372
esv3602487 CNV loss 21293372
esv3602490 CNV loss 21293372
esv4656 CNV loss 18987735
esv989976 CNV deletion 20482838
esv997092 CNV deletion 20482838
nsv1027781 CNV gain 25217958
nsv1073376 CNV deletion 25765185
nsv1074219 CNV deletion 25765185
nsv1074220 CNV deletion 25765185
nsv1109642 CNV deletion 24896259
nsv1109643 CNV deletion 24896259
nsv1123851 CNV deletion 24896259
nsv1143105 CNV tandem duplication 24896259
nsv1143293 CNV deletion 24896259
nsv1146534 CNV deletion 26484159
nsv1154113 CNV deletion 26484159
nsv292010 CNV deletion 16902084
nsv292161 CNV deletion 16902084
nsv292163 CNV deletion 16902084
nsv292381 CNV deletion 16902084
nsv292962 CNV insertion 16902084
nsv441917 CNV loss 18776908
nsv461660 CNV gain 19166990
nsv472508 CNV novel sequence insertion 20440878
nsv478686 CNV novel sequence insertion 20440878
nsv509937 OTHER sequence alteration 20534489
nsv595604 CNV loss 21841781
nsv595605 CNV gain 21841781
nsv595606 CNV loss 21841781
nsv830096 CNV gain 17160897
nsv830097 CNV gain 17160897
nsv830098 CNV gain 17160897
nsv830099 CNV gain 17160897
nsv830100 CNV gain 17160897
nsv830101 CNV loss 17160897
nsv956914 CNV deletion 24416366

Variation tolerance for INPP4B Gene

Residual Variation Intolerance Score: 8.97% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.17; 39.25% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for INPP4B Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
INPP4B

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for INPP4B Gene

Disorders for INPP4B Gene

MalaCards: The human disease database

(1) MalaCards diseases for INPP4B Gene - From: DISEASES

Disorder Aliases PubMed IDs
vulva adenocarcinoma
  • adenocarcinoma of the vulva
- elite association - COSMIC cancer census association via MalaCards

Additional Disease Information for INPP4B

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with INPP4B: view

No data available for UniProtKB/Swiss-Prot and Genatlas for INPP4B Gene

Publications for INPP4B Gene

  1. The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family. (PMID: 9295334) Norris FA … Majerus PW (The Journal of biological chemistry 1997) 2 3 4 22 58
  2. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 44 58
  3. Evidence that inositol polyphosphate 4-phosphatase type II is a tumor suppressor that inhibits PI3K signaling. (PMID: 19647222) Gewinner C … Cantley LC (Cancer cell 2009) 3 22 58
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
  5. Basal biomarkers nestin and INPP4b identify intrinsic subtypes accurately in breast cancers that are weakly positive for oestrogen receptor. (PMID: 27402148) Asleh-Aburaya K … Nielsen TO (Histopathology 2017) 3 58

Products for INPP4B Gene

Sources for INPP4B Gene

Content
Loading form....