INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type ... See more...

Aliases for INPP4B Gene

Aliases for INPP4B Gene

  • Inositol Polyphosphate-4-Phosphatase Type II B 2 3 5
  • Inositol Polyphosphate-4-Phosphatase, Type II, 105kDa 2 3
  • Type II Inositol 3,4-Bisphosphate 4-Phosphatase 3 4
  • Inositol Polyphosphate 4-Phosphatase Type II 3 4
  • EC 3.1.3.66 4 50
  • Inositol Polyphosphate 4-Phosphatase II; 4-Phosphatase II 3
  • Inositol Polyphosphate-4-Phosphatase, Type II, 105kD 2
  • INPP4B 5

External Ids for INPP4B Gene

Previous GeneCards Identifiers for INPP4B Gene

  • GC04M143812
  • GC04M143266
  • GC04M143415
  • GC04M143527
  • GC04M143526
  • GC04M143306
  • GC04M142949
  • GC04M138678

Summaries for INPP4B Gene

Entrez Gene Summary for INPP4B Gene

  • INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme. [provided by RefSeq, Jul 2008]

GeneCards Summary for INPP4B Gene

INPP4B (Inositol Polyphosphate-4-Phosphatase Type II B) is a Protein Coding gene. Among its related pathways are Glycerophospholipid biosynthesis and superpathway of inositol phosphate compounds. Gene Ontology (GO) annotations related to this gene include lipid binding and phosphatidylinositol trisphosphate phosphatase activity. An important paralog of this gene is INPP4A.

UniProtKB/Swiss-Prot Summary for INPP4B Gene

  • Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-trisphosphate (PubMed:24070612, PubMed:24591580). Plays a role in the late stages of macropinocytosis by dephosphorylating phosphatidylinositol 3,4-bisphosphate in membrane ruffles (PubMed:24591580). The lipid phosphatase activity is critical for tumor suppressor function. Antagonizes the PI3K-AKT/PKB signaling pathway by dephosphorylating phosphoinositides and thereby modulating cell cycle progression and cell survival (PubMed:19647222, PubMed:24070612).

No data available for CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for INPP4B Gene

Genomics for INPP4B Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for INPP4B Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH04J142845 Promoter/Enhancer 1.6 EPDnew Ensembl ENCODE CraniofacialAtlas 250.7 +1.2 1231 2.8 ZNF654 CTCF SIN3A ZNF513 ELF1 RAD21 SMC3 GLIS1 ZNF398 ZNF560 INPP4B lnc-FREM3-7 HSALNG0037560
GH04J142473 Promoter/Enhancer 1.4 EPDnew Ensembl ENCODE 250 +373.8 373759 4.1 JUND CEBPB ZNF217 EP300 MBD2 ELF1 CTBP1 SIN3A TCF7L2 CTCF INPP4B ENSG00000251248 lnc-FREM3-9 piR-60246-122 IL15
GH04J142561 Promoter/Enhancer 0.7 EPDnew Ensembl dbSUPER 250.1 +287.0 287029 0.8 INPP4B LOC101927613 ENSG00000249806 HSALNG0037558 IL15
GH04J142516 Promoter/Enhancer 0.6 EPDnew Ensembl 250.1 +330.5 330531 1.4 HNF4A INPP4B ENSG00000251248 lnc-FREM3-9 HSALNG0037558 IL15
GH04J142398 Promoter/Enhancer 2.1 FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 13.9 +443.1 443116 11 ZNF600 BCL11A CEBPB TRIM22 FEZF1 EP300 FOXA2 CUX1 STAT3 EBF1 INPP4B piR-60246-122 lnc-FREM3-9 ENSG00000251248 IL15
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around INPP4B on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for INPP4B

Top Transcription factor binding sites by QIAGEN in the INPP4B gene promoter:
  • AML1a
  • c-Myb
  • c-Rel
  • FOXD3
  • Gfi-1
  • Oct-B1
  • oct-B2
  • POU6F1 (c2)
  • SRF
  • SRF (504 AA)

Genomic Locations for INPP4B Gene

Latest Assembly
chr4:142,023,160-142,847,432
(GRCh38/hg38)
Size:
824,273 bases
Orientation:
Minus strand

Previous Assembly
chr4:142,944,313-143,767,688
(GRCh37/hg19 by Entrez Gene)
Size:
823,376 bases
Orientation:
Minus strand

chr4:142,944,313-143,768,585
(GRCh37/hg19 by Ensembl)
Size:
824,273 bases
Orientation:
Minus strand

Genomic View for INPP4B Gene

Genes around INPP4B on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
INPP4B Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for INPP4B Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for INPP4B Gene

Proteins for INPP4B Gene

  • Protein details for INPP4B Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O15327-INP4B_HUMAN
    Recommended name:
    Inositol polyphosphate 4-phosphatase type II
    Protein Accession:
    O15327
    Secondary Accessions:
    • Q2TAI2
    • Q5XLE7
    • Q6IN59
    • Q6PJB4

    Protein attributes for INPP4B Gene

    Size:
    924 amino acids
    Molecular mass:
    104738 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAH72447.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence.; Evidence={ECO:0000305};

    Alternative splice isoforms for INPP4B Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for INPP4B Gene

Selected DME Specific Peptides for INPP4B Gene

O15327:
  • IKLTVYDVKDK
  • INQLQPL
  • PNEPQLEFILAC
  • LSLRTSDGGKVVGTIEVS
  • YRPPEGTYGK
  • MSVTLEQC
  • SVIHPVEQ
  • SASQHSPDSL
  • SHPREDWYEQL
  • DPLFLTGVTFP
  • ASFKVGELLKSKEQLL
  • NLHLQRMQVHSPHLKDALYDVITVGAPAAHFQGFKNGGLR
  • IFMEKMPPDYISHFQEQ
  • YAFNMLQLMAFPK
  • ATHADLLL
  • VDKLIERD
  • SNDVLPV
  • LTRYSSTEIVEGT
  • YPIYEET
  • PVLFNVGINEQQTLAERFGD
  • CKSAKDRT
  • VKMGEIEDG
  • TGRREHYVVEVKLPA
  • CGFIIKL

Post-translational modifications for INPP4B Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibodies for research

  • Abcam antibodies for INPP4B

Domains & Families for INPP4B Gene

Gene Families for INPP4B Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for INPP4B Gene

InterPro:
Blocks:
  • Polysaccharide lyase family 8-like, C-terminal

Suggested Antigen Peptide Sequences for INPP4B Gene

GenScript: Design optimal peptide antigens:
  • Inositol polyphosphate 4-phosphatase type II (INP4B_HUMAN)

Graphical View of Domain Structure for InterPro Entry

O15327

UniProtKB/Swiss-Prot:

INP4B_HUMAN :
  • Belongs to the inositol 3,4-bisphosphate 4-phosphatase family.
Family:
  • Belongs to the inositol 3,4-bisphosphate 4-phosphatase family.
genes like me logo Genes that share domains with INPP4B: view

Function for INPP4B Gene

Molecular function for INPP4B Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-trisphosphate (PubMed:24070612, PubMed:24591580). Plays a role in the late stages of macropinocytosis by dephosphorylating phosphatidylinositol 3,4-bisphosphate in membrane ruffles (PubMed:24591580). The lipid phosphatase activity is critical for tumor suppressor function. Antagonizes the PI3K-AKT/PKB signaling pathway by dephosphorylating phosphoinositides and thereby modulating cell cycle progression and cell survival (PubMed:19647222, PubMed:24070612).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + phosphate; Xref=Rhea:RHEA:17193, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474, ChEBI:CHEBI:57658, ChEBI:CHEBI:58088; EC=3.1.3.66; Evidence={ECO:0000269|PubMed:19647222, ECO:0000269|PubMed:24070612, ECO:0000305|PubMed:24591580};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1D-myo-inositol 1,3,4-trisphosphate + H2O = 1D-myo-inositol 1,3-bisphosphate + phosphate; Xref=Rhea:RHEA:43392, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474, ChEBI:CHEBI:58414, ChEBI:CHEBI:83242; Evidence={ECO:0000269|PubMed:24070612};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1D-myo-inositol 3,4-bisphosphate + H2O = 1D-myo-inositol 3-phosphate + phosphate; Xref=Rhea:RHEA:43388, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474, ChEBI:CHEBI:58401, ChEBI:CHEBI:83241; Evidence={ECO:0000250|UniProtKB:Q9QWG5};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Strongly inhibited by inositol hexakisphosphate.

Enzyme Numbers (IUBMB) for INPP4B Gene

Phenotypes From GWAS Catalog for INPP4B Gene

Gene Ontology (GO) - Molecular Function for INPP4B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 24407287
GO:0016316 phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity IEA,IBA 21873635
GO:0016787 hydrolase activity IEA --
GO:0034597 phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity IEA --
genes like me logo Genes that share ontologies with INPP4B: view
genes like me logo Genes that share phenotypes with INPP4B: view

Animal Models for INPP4B Gene

MGI Knock Outs for INPP4B:

miRNA for INPP4B Gene

miRTarBase miRNAs that target INPP4B

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for INPP4B

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for INPP4B Gene

Localization for INPP4B Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for INPP4B gene
Compartment Confidence
cytosol 4
cytoskeleton 3
plasma membrane 2
extracellular 2
nucleus 2
endosome 2
mitochondrion 1
endoplasmic reticulum 1
lysosome 1
golgi apparatus 1
peroxisome 0

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for INPP4B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IBA 21873635
GO:0005829 cytosol TAS --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with INPP4B: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for INPP4B Gene

Pathways & Interactions for INPP4B Gene

genes like me logo Genes that share pathways with INPP4B: view

Pathways by source for INPP4B Gene

UniProtKB/Swiss-Prot O15327-INP4B_HUMAN

  • Pathway: Signal transduction; phosphatidylinositol signaling pathway.

Interacting Proteins for INPP4B Gene

STRING Interaction Network Preview (showing top 5 STRING interactants - click image to see top 25)
STRING Interaction Network
Selected Interacting proteins: ENSP00000425487 O15327-INP4B_HUMAN for INPP4B Gene via STRING IID

Gene Ontology (GO) - Biological Process for INPP4B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006661 phosphatidylinositol biosynthetic process TAS --
GO:0007165 signal transduction TAS 9295334
GO:0016311 dephosphorylation IEA --
GO:0036092 phosphatidylinositol-3-phosphate biosynthetic process IEA --
GO:0043647 inositol phosphate metabolic process TAS --
genes like me logo Genes that share ontologies with INPP4B: view

No data available for SIGNOR curated interactions for INPP4B Gene

Drugs & Compounds for INPP4B Gene

(2) Drugs for INPP4B Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Water Approved Pharma 0
Phosphate Experimental Pharma 0

(3) Additional Compounds for INPP4B Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
D-myo-Inositol 3,4-bisphosphate
  • D-Myo-inositol 3,4-bisphosphate
  • Inositol 3,4-bisphosphate
  • D-Myo-inositol 3,4-bisphosphoric acid
  • Inositol 3,4-bisphosphoric acid
  • 1D-Myo-inositol 3,4-bisphosphoric acid
69256-53-7
D-myo-Inositol 3-phosphate
  • 1D-Myo-inositol 3-monophosphate
  • 1l-Myo-inositol 1-phosphate
  • D-Myo-inositol 3-monophosphate
  • Inositol 3-phosphate
  • L-Myo-inositol 1-phosphate
2831-74-5
Inositol phosphate
  • 1D-Myo-inositol 1-monophosphate
  • D-Myo-inositol 1-phosphate
  • I1P
  • Inositol 1-phosphate
  • Ins(1)p
15421-51-9
genes like me logo Genes that share compounds with INPP4B: view

Transcripts for INPP4B Gene

mRNA/cDNA for INPP4B Gene

34 REFSEQ mRNAs :
18 NCBI additional mRNA sequence :
23 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for INPP4B

Alternative Splicing Database (ASD) splice patterns (SP) for INPP4B Gene

No ASD Table

Relevant External Links for INPP4B Gene

GeneLoc Exon Structure for
INPP4B

Expression for INPP4B Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for INPP4B Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for INPP4B Gene

This gene is overexpressed in Peripheral blood mononuclear cells (13.1), Bone (10.7), Lung (8.9), and Breast (8.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for INPP4B Gene



Protein tissue co-expression partners for INPP4B Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for INPP4B

SOURCE GeneReport for Unigene cluster for INPP4B Gene:

Hs.531403

mRNA Expression by UniProt/SwissProt for INPP4B Gene:

O15327-INP4B_HUMAN
Tissue specificity: Widely expressed with highest levels occurring in the skeletal muscle and heart.

Evidence on tissue expression from TISSUES for INPP4B Gene

  • Nervous system(4.5)
  • Skin(4.4)
  • Blood(2.3)
  • Heart(2.2)
genes like me logo Genes that share expression patterns with INPP4B: view

Primer products for research

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for INPP4B Gene

Orthologs for INPP4B Gene

This gene was present in the common ancestor of animals.

Orthologs for INPP4B Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia INPP4B 29 30
  • 99.6 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia INPP4B 29 30
  • 91.41 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia INPP4B 29 30
  • 87.48 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Inpp4b 29 16 30
  • 86.83 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Inpp4b 29
  • 85.61 (n)
Platypus
(Ornithorhynchus anatinus)
Mammalia INPP4B 30
  • 78 (a)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia INPP4B 30
  • 75 (a)
OneToOne
Chicken
(Gallus gallus)
Aves INPP4B 29 30
  • 79.16 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia INPP4B 30
  • 69 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia inpp4b 29
  • 72.52 (n)
Zebrafish
(Danio rerio)
Actinopterygii inpp4b 29 30
  • 62.31 (n)
OneToOne
Dr.22355 29
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.2969 29
Fruit Fly
(Drosophila melanogaster)
Insecta CG1846 31
  • 35 (a)
CG42271 30
  • 21 (a)
OneToMany
Worm
(Caenorhabditis elegans)
Secernentea R01H10.7 30
  • 24 (a)
OneToMany
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 30
  • 38 (a)
OneToMany
Species where no ortholog for INPP4B was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for INPP4B Gene

ENSEMBL:
Gene Tree for INPP4B (if available)
TreeFam:
Gene Tree for INPP4B (if available)
Aminode:
Evolutionary constrained regions (ECRs) for INPP4B: view image
Alliance of Genome Resources:
Additional Orthologs for INPP4B

Paralogs for INPP4B Gene

Paralogs for INPP4B Gene

(1) SIMAP similar genes for INPP4B Gene using alignment to 12 proteins:

  • INP4B_HUMAN
  • D6R9J5_HUMAN
  • D6RDJ7_HUMAN
  • D6RE59_HUMAN
  • D6RJC3_HUMAN
  • E7EQN9_HUMAN
  • E9PCZ3_HUMAN
  • E9PG59_HUMAN
  • E9PHC0_HUMAN
  • H0Y9Q3_HUMAN
  • H0YA10_HUMAN
  • Q9BS68_HUMAN
genes like me logo Genes that share paralogs with INPP4B: view

Variants for INPP4B Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for INPP4B Gene

SNP ID Clinical significance and condition Chr 04 pos Variation AA Info Type
rs1064226 -- p.Tyr311Phe

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for INPP4B Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for INPP4B Gene

Variant ID Type Subtype PubMed ID
dgv1031e214 CNV loss 21293372
dgv3089e59 CNV tandem duplication 20981092
dgv850e201 CNV deletion 23290073
esv1010249 CNV deletion 20482838
esv1151116 CNV deletion 17803354
esv1561602 CNV deletion 17803354
esv21478 CNV loss 19812545
esv2256713 CNV deletion 18987734
esv2279055 CNV deletion 18987734
esv2659841 CNV deletion 23128226
esv2674465 CNV deletion 23128226
esv2675652 CNV deletion 23128226
esv2677141 CNV deletion 23128226
esv2728453 CNV deletion 23290073
esv2728454 CNV deletion 23290073
esv2728455 CNV deletion 23290073
esv2728456 CNV deletion 23290073
esv2728457 CNV deletion 23290073
esv2728459 CNV deletion 23290073
esv2728461 CNV deletion 23290073
esv2728463 CNV deletion 23290073
esv2728464 CNV deletion 23290073
esv2728465 CNV deletion 23290073
esv2728466 CNV deletion 23290073
esv2728467 CNV deletion 23290073
esv2728468 CNV deletion 23290073
esv2728469 CNV deletion 23290073
esv2728470 CNV deletion 23290073
esv2762467 CNV loss 21179565
esv3058892 CNV deletion 24192839
esv3389600 CNV insertion 20981092
esv3396063 CNV duplication 20981092
esv3434346 CNV insertion 20981092
esv3564742 CNV deletion 23714750
esv3602477 CNV loss 21293372
esv3602479 CNV loss 21293372
esv3602484 CNV loss 21293372
esv3602485 CNV gain 21293372
esv3602487 CNV loss 21293372
esv3602490 CNV loss 21293372
esv4656 CNV loss 18987735
esv989976 CNV deletion 20482838
esv997092 CNV deletion 20482838
nsv1027781 CNV gain 25217958
nsv1073376 CNV deletion 25765185
nsv1074219 CNV deletion 25765185
nsv1074220 CNV deletion 25765185
nsv1109642 CNV deletion 24896259
nsv1109643 CNV deletion 24896259
nsv1123851 CNV deletion 24896259
nsv1143105 CNV tandem duplication 24896259
nsv1143293 CNV deletion 24896259
nsv1146534 CNV deletion 26484159
nsv1154113 CNV deletion 26484159
nsv292010 CNV deletion 16902084
nsv292161 CNV deletion 16902084
nsv292163 CNV deletion 16902084
nsv292381 CNV deletion 16902084
nsv292962 CNV insertion 16902084
nsv441917 CNV loss 18776908
nsv461660 CNV gain 19166990
nsv472508 CNV novel sequence insertion 20440878
nsv478686 CNV novel sequence insertion 20440878
nsv509937 OTHER sequence alteration 20534489
nsv595604 CNV loss 21841781
nsv595605 CNV gain 21841781
nsv595606 CNV loss 21841781
nsv830096 CNV gain 17160897
nsv830097 CNV gain 17160897
nsv830098 CNV gain 17160897
nsv830099 CNV gain 17160897
nsv830100 CNV gain 17160897
nsv830101 CNV loss 17160897
nsv956914 CNV deletion 24416366

Variation tolerance for INPP4B Gene

Residual Variation Intolerance Score: 8.97% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.17; 39.25% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for INPP4B Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
INPP4B
Leiden Open Variation Database (LOVD)
INPP4B

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for INPP4B Gene

Disorders for INPP4B Gene

Additional Disease Information for INPP4B

Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform

No disorders were found for INPP4B Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for INPP4B Gene

Publications for INPP4B Gene

  1. The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family. (PMID: 9295334) Norris FA … Majerus PW (The Journal of biological chemistry 1997) 2 3 4 22
  2. Evidence that inositol polyphosphate 4-phosphatase type II is a tumor suppressor that inhibits PI3K signaling. (PMID: 19647222) Gewinner C … Cantley LC (Cancer cell 2009) 3 4 22
  3. Sequential breakdown of 3-phosphorylated phosphoinositides is essential for the completion of macropinocytosis. (PMID: 24591580) Maekawa M … Arai H (Proceedings of the National Academy of Sciences of the United States of America 2014) 3 4
  4. Determinants of the tumor suppressor INPP4B protein and lipid phosphatase activities. (PMID: 24070612) Lopez SM … Agoulnik IU (Biochemical and biophysical research communications 2013) 3 4
  5. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 40

Products for INPP4B Gene

Sources for INPP4B Gene