IGF1R Gene (Protein Coding)

Insulin Like Growth Factor 1 Receptor

GC15P098648
GIFtS:
54
This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. ... See more...

Aliases for IGF1R Gene

Aliases for IGF1R Gene

  • Insulin Like Growth Factor 1 Receptor 2 3 5
  • Insulin-Like Growth Factor 1 Receptor 2 3 4
  • IGF-I Receptor 3 4
  • EC 2.7.10.1 4 51
  • CD221 2 3
  • IGFIR 2 3
  • JTK13 2 3
  • IGFR 2 3
  • Insulin-Like Growth Factor I Receptor 4
  • Soluble IGF1R Variant 1 3
  • Soluble IGF1R Variant 2 3
  • CD221 Antigen 4
  • EC 2.7.10 51
  • MGC18216 2
  • IGF1R 5

External Ids for IGF1R Gene

Previous GeneCards Identifiers for IGF1R Gene

  • GC15P095878
  • GC15P093033
  • GC15P096785
  • GC15P096928
  • GC15P097010
  • GC15P099192
  • GC15P075320

Summaries for IGF1R Gene

Entrez Gene Summary for IGF1R Gene

  • This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]

CIViC Summary for IGF1R Gene

GeneCards Summary for IGF1R Gene

IGF1R (Insulin Like Growth Factor 1 Receptor) is a Protein Coding gene. Diseases associated with IGF1R include Insulin-Like Growth Factor I and Ring Chromosome 15. Among its related pathways are Apoptosis Modulation and Signaling and Transcriptional misregulation in cancer. Gene Ontology (GO) annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is INSR.

UniProtKB/Swiss-Prot Summary for IGF1R Gene

  • Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway and the Ras-MAPK pathway. The result of activating the MAPK pathway is increased cellular proliferation, whereas activating the PI3K pathway inhibits apoptosis and stimulates protein synthesis. Phosphorylated IRS1 can activate the 85 kDa regulatory subunit of PI3K (PIK3R1), leading to activation of several downstream substrates, including protein AKT/PKB. AKT phosphorylation, in turn, enhances protein synthesis through mTOR activation and triggers the antiapoptotic effects of IGFIR through phosphorylation and inactivation of BAD. In parallel to PI3K-driven signaling, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc leads to recruitment of Ras and activation of the ras-MAPK pathway. In addition to these two main signaling pathways IGF1R signals also through the Janus kinase/signal transducer and activator of transcription pathway (JAK/STAT). Phosphorylation of JAK proteins can lead to phosphorylation/activation of signal transducers and activators of transcription (STAT) proteins. In particular activation of STAT3, may be essential for the transforming activity of IGF1R. The JAK/STAT pathway activates gene transcription and may be responsible for the transforming activity. JNK kinases can also be activated by the IGF1R. IGF1 exerts inhibiting activities on JNK activation via phosphorylation and inhibition of MAP3K5/ASK1, which is able to directly associate with the IGF1R.
  • When present in a hybrid receptor with INSR, binds IGF1. PubMed:12138094 shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, PubMed:16831875 shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.

Tocris Summary for IGF1R Gene

  • Insulin receptors (IRs) and insulin-like growth factor receptors (IGFRs) are formed from two subunits, each of which is comprised of an extracellular alpha-subunit and a transmembrane beta-subunit with intracellular tyrosine kinase activity. IR homodimers are activated by insulin.

Gene Wiki entry for IGF1R Gene

Additional gene information for IGF1R Gene

No data available for PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for IGF1R Gene

Genomics for IGF1R Gene

GeneHancer (GH) Regulatory Elements Pubs

Download GeneHancer 2017 data
Promoters and enhancers for IGF1R Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH15J098646 Promoter/Enhancer 2.5 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 607 +1.7 1713 8.1 RNF2 SP1 HNRNPL CREB1 GATAD2A PRDM10 ZNF629 NFKBIZ KDM1A CTCF IGF1R IRAIN PGPEP1L
GH15J098922 Promoter/Enhancer 1.2 EPDnew Ensembl ENCODE dbSUPER 600.1 +275.5 275504 2.5 ZNF316 MAFF MAFK MAFG NFIC NR2F2 HLF EMSY HE856005 IGF1R ENSG00000259621 PGPEP1L
GH15J098850 Promoter/Enhancer 1.9 FANTOM5 ENCODE CraniofacialAtlas dbSUPER 15.3 +206.1 206074 9.1 SP1 CREB1 CTCF PRDM10 ZNF692 BACH1 FOS TARDBP ZHX2 FOXA1 IGF1R TTC23 ENSG00000259921 ENSG00000287191 ENSG00000259621 PGPEP1L
GH15J098864 Promoter/Enhancer 2.1 FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 10.7 +218.6 218575 4.4 CREB1 PRDM10 TFE3 ZNF692 ZHX2 FOXA1 PRDM1 REST POLR2A HDAC1 IGF1R ENSG00000259921 TTC23 ENSG00000287191 ENSG00000259621 PGPEP1L
GH15J098742 Promoter/Enhancer 1.2 Ensembl ENCODE dbSUPER 18.5 +96.6 96556 5.4 SCRT2 RFX1 JUND CTBP1 ZBTB48 PKNOX1 MBD2 POLR2A DPF2 CTCF IGF1R HSALNG0108511 piR-43106-083 PGPEP1L
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around IGF1R on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for IGF1R

Top Transcription factor binding sites by QIAGEN in the IGF1R gene promoter:
  • aMEF-2
  • AP-1
  • MEF-2A
  • STAT1
  • STAT3
  • TBP

Genomic Locations for IGF1R Gene

Genomic Locations for IGF1R Gene
chr15:98,648,539-98,964,530
(GRCh38/hg38)
Size:
315,992 bases
Orientation:
Plus strand
chr15:99,192,200-99,507,759
(GRCh37/hg19)
Size:
315,560 bases
Orientation:
Plus strand

Genomic View for IGF1R Gene

Genes around IGF1R on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
IGF1R Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for IGF1R Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for IGF1R Gene

Proteins for IGF1R Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for IGF1R Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P08069-IGF1R_HUMAN
    Recommended name:
    Insulin-like growth factor 1 receptor
    Protein Accession:
    P08069
    Secondary Accessions:
    • B1B5Y2
    • Q14CV2
    • Q9UCC0

    Protein attributes for IGF1R Gene

    Size:
    1367 amino acids
    Molecular mass:
    154793 Da
    Quaternary structure:
    • Tetramer of 2 alpha and 2 beta chains linked by disulfide bonds. The alpha chains contribute to the formation of the ligand-binding domain, while the beta chain carries the kinase domain. Interacts with PIK3R1 and with the PTB/PID domains of IRS1 and SHC1 in vitro when autophosphorylated on tyrosine residues. Forms a hybrid receptor with INSR, the hybrid is a tetramer consisting of 1 alpha chain and 1 beta chain of INSR and 1 alpha chain and 1 beta chain of IGF1R. Interacts with ARRB1 and ARRB2. Interacts with GRB10. Interacts with RACK1. Interacts with SOCS1, SOCS2 and SOCS3. Interacts with 14-3-3 proteins. Interacts with NMD2. Interacts with MAP3K5. Interacts with STAT3. Found in a ternary complex with IGF1 and ITGAV:ITGB3 or ITGA6:ITGB4 (PubMed:19578119, PubMed:22351760). Interacts (nascent precursor form) with ZFAND2B (PubMed:26692333).
    SequenceCaution:
    • Sequence=BAG11657.1; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for IGF1R Gene

neXtProt entry for IGF1R Gene

Protein Expression for IGF1R Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for IGF1R Gene

P08069:
  • DGQDACG
  • LMRMCWQ
  • IGLYNLRNITRGA
  • LENCTVIEG
  • PESLKDG
  • RDLAARN
  • YALVIFEM
  • YVPDEWEV
  • AIKTVNE
  • FPNLTVI
  • GVVSQGQPT
  • GLLPVRWM
  • MCWQYNPKMRP
  • SASNSSSQL
  • GVVLWEI
  • GPGVLVLRASFDERQPYAHMNGGR
  • RERIEFLNEASVMK
  • RYRPPDYRDLISFTVYYKEAPF
  • FGMVYEG
  • FNCHHVV
  • AKGVVKDE
  • RLGNGVLYASVNPEYFSAA
  • MEEVTGTKGRQ
  • KTIDSVTSAQ
  • KFVHRDLAARNCMV
  • HVVRLLGV
  • ERTVISNL
  • SNEQVLRFVMEGGLL
  • PVRWMSPE
  • VTGYVKIRHSHALVSLSFLK
  • CCHPECLGSC
  • PNGLILMYEI
  • EAEYRKVFENFLHNSIFVPRP
  • NNYIVGNKPPKEC
  • LKPWTQYA
  • PFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPA
  • PCEGPCPK
  • DGMAYLNA
  • CACPKTEAE
  • EIADGMAYL
  • FVHRDLA
  • QPYQGLSNE
  • GPCPKVC

Post-translational modifications for IGF1R Gene

  • Autophosphorylated on tyrosine residues in response to ligand binding. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit. Autophosphorylation occurs in a sequential manner; Tyr-1165 is predominantly phosphorylated first, followed by phosphorylation of Tyr-1161 and Tyr-1166. While every single phosphorylation increases kinase activity, all three tyrosine residues in the kinase activation loop (Tyr-1165, Tyr-1161 and Tyr-1166) have to be phosphorylated for optimal activity. Can be autophosphorylated at additional tyrosine residues (in vitro). Autophosphorylated is followed by phosphorylation of juxtamembrane tyrosines and C-terminal serines. Phosphorylation of Tyr-980 is required for IRS1- and SHC1-binding. Phosphorylation of Ser-1278 by GSK-3beta restrains kinase activity and promotes cell surface expression, it requires a priming phosphorylation at Ser-1282. Dephosphorylated by PTPN1 (By similarity).
  • Polyubiquitinated at Lys-1168 and Lys-1171 through both 'Lys-48' and 'Lys-29' linkages, promoting receptor endocytosis and subsequent degradation by the proteasome. Ubiquitination is facilitated by pre-existing phosphorylation.
  • Sumoylated with SUMO1.
  • Controlled by regulated intramembrane proteolysis (RIP). Undergoes metalloprotease-dependent constitutive ectodomain shedding to produce a membrane-anchored 52 kDa C-Terminal fragment which is further processed by presenilin gamma-secretase to yield an intracellular 50 kDa fragment.
  • Glycosylation at Asn51, Asn102, Asn135, Asn244, Asn314, Asn417, Asn438, Asn534, Asn607, Asn622, Asn640, Asn747, Asn756, Asn764, Asn900, and Asn913
  • Ubiquitination at Lys1033, Lys1168, and Lys1171
  • Modification sites at PhosphoSitePlus

Other Protein References for IGF1R Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibody Products

Domains & Families for IGF1R Gene

Gene Families for IGF1R Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • CD markers
  • Disease related genes
  • Enzymes
  • FDA approved drug targets
  • Plasma proteins
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for IGF1R Gene

InterPro:
Blocks:
  • Tyrosine protein kinase, active site
  • Cytosolic fatty-acid binding protein
  • Epidermal growth-factor receptor (EGFR), L domain
  • Furin-like cysteine rich region
  • Furin-like repeat
  • Receptor tyrosine kinase, class II
ProtoNet:

Suggested Antigen Peptide Sequences for IGF1R Gene

GenScript: Design optimal peptide antigens:
  • Tyrosine-protein kinase receptor (C9J5X1_HUMAN)
  • Insulin-like growth factor I receptor (IGF1R_HUMAN)
  • IGF1R protein (Q3B833_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P08069

UniProtKB/Swiss-Prot:

IGF1R_HUMAN :
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
genes like me logo Genes that share domains with IGF1R: view

Function for IGF1R Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line

Molecular function for IGF1R Gene

UniProtKB/Swiss-Prot Function:
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway and the Ras-MAPK pathway. The result of activating the MAPK pathway is increased cellular proliferation, whereas activating the PI3K pathway inhibits apoptosis and stimulates protein synthesis. Phosphorylated IRS1 can activate the 85 kDa regulatory subunit of PI3K (PIK3R1), leading to activation of several downstream substrates, including protein AKT/PKB. AKT phosphorylation, in turn, enhances protein synthesis through mTOR activation and triggers the antiapoptotic effects of IGFIR through phosphorylation and inactivation of BAD. In parallel to PI3K-driven signaling, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc leads to recruitment of Ras and activation of the ras-MAPK pathway. In addition to these two main signaling pathways IGF1R signals also through the Janus kinase/signal transducer and activator of transcription pathway (JAK/STAT). Phosphorylation of JAK proteins can lead to phosphorylation/activation of signal transducers and activators of transcription (STAT) proteins. In particular activation of STAT3, may be essential for the transforming activity of IGF1R. The JAK/STAT pathway activates gene transcription and may be responsible for the transforming activity. JNK kinases can also be activated by the IGF1R. IGF1 exerts inhibiting activities on JNK activation via phosphorylation and inhibition of MAP3K5/ASK1, which is able to directly associate with the IGF1R.
UniProtKB/Swiss-Prot Function:
When present in a hybrid receptor with INSR, binds IGF1. PubMed:12138094 shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, PubMed:16831875 shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]; Xref=Rhea:RHEA:10596, Rhea:RHEA-COMP:10136, Rhea:RHEA-COMP:10137, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:46858, ChEBI:CHEBI:82620, ChEBI:CHEBI:456216; EC=2.7.10.1; Evidence={ECO:0000255|PROSITE-ProRule:PRU10028, ECO:0000269|PubMed:11694888, ECO:0000269|PubMed:17317169, ECO:0000269|PubMed:18566589, ECO:0000269|PubMed:19041240, ECO:0000269|PubMed:19778024, ECO:0000269|PubMed:20675137, ECO:0000269|PubMed:21414779, ECO:0000269|PubMed:21441024, ECO:0000269|PubMed:7679099, ECO:0000269|Ref.53};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by autophosphorylation at Tyr-1165, Tyr-1161 and Tyr-1166 on the kinase activation loop; phosphorylation at all three tyrosine residues is required for optimal kinase activity. Inhibited by MSC1609119A-1, BMS-754807, PQIP, benzimidazole pyridinone, isoquinolinedione, bis-azaindole, 3-cyanoquinoline, 2,4-bis-arylamino-1,3-pyrimidine, pyrrolopyrimidine, pyrrole-5-carboxaldehyde, picropodophyllin (PPP), tyrphostin derivatives. While most inhibitors bind to the ATP binding pocket, MSC1609119A-1 functions as allosteric inhibitor and binds close to the DFG motif and the activation loop.
GENATLAS Biochemistry:
insulin-like growth factor 1,receptor

Enzyme Numbers (IUBMB) for IGF1R Gene

Phenotypes From GWAS Catalog for IGF1R Gene

Gene Ontology (GO) - Molecular Function for IGF1R Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004713 protein tyrosine kinase activity IEA,TAS --
GO:0004714 transmembrane receptor protein tyrosine kinase activity IEA,IBA 21873635
GO:0005009 insulin-activated receptor activity IBA 21873635
genes like me logo Genes that share ontologies with IGF1R: view

Phenotypes for IGF1R Gene

MGI mutant phenotypes for IGF1R:
inferred from 8 alleles
GenomeRNAi human phenotypes for IGF1R:
genes like me logo Genes that share phenotypes with IGF1R: view

Human Phenotype Ontology for IGF1R Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for IGF1R Gene

MGI Knock Outs for IGF1R:

Animal Model Products

  • Taconic Biosciences Mouse Models for IGF1R

CRISPR Products

miRNA for IGF1R Gene

miRTarBase miRNAs that target IGF1R

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for IGF1R

No data available for Transcription Factor Targets and HOMER Transcription for IGF1R Gene

Localization for IGF1R Gene

Subcellular locations from UniProtKB/Swiss-Prot for IGF1R Gene

Cell membrane. Single-pass type I membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for IGF1R gene
Compartment Confidence
plasma membrane 5
extracellular 3
cytoskeleton 3
mitochondrion 3
nucleus 3
cytosol 3
peroxisome 2
endoplasmic reticulum 2
endosome 2
lysosome 2
golgi apparatus 2

Subcellular locations from the

Human Protein Atlas (HPA)
  • Vesicles (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for IGF1R Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005623 cell IEA --
GO:0005886 plasma membrane ISS,TAS --
GO:0005887 integral component of plasma membrane IBA,IC 7679099
GO:0005899 insulin receptor complex IBA 21873635
GO:0016020 membrane IEA,IDA 8452530
genes like me logo Genes that share ontologies with IGF1R: view

Pathways & Interactions for IGF1R Gene

PathCards logo

SuperPathways for IGF1R Gene

SuperPathway Contained pathways
1 Apoptotic Pathways in Synovial Fibroblasts
Cellular Apoptosis Pathway
.85
Mitochondrial Apoptosis
.85
Apoptotic Pathways in Synovial Fibroblasts
.84
p53 Mediated Apoptosis
.84
DHA Signaling
.74
Telomerase Components in Cell Signaling
.72
PPAR Pathway
.66
Rac1 Pathway
.65
Actin-Based Motility by Rho Family GTPases
.62
ERK5 Signaling
.61
eIF2 Pathway
.60
Rap1 Pathway
.57
Nuclear Receptor Activation by Vitamin-A
.57
2 GPCR Pathway
Paxillin Interactions
.73
Ras Pathway
.73
GPCR Pathway
.62
Pancreatic Adenocarcinoma
.59
Breast Cancer Regulation by Stathmin1
.58
NFAT in Immune Response
.58
Estrogen Pathway
.55
P2Y Receptor Signaling
.38
3 ERK Signaling
ERK Signaling
.61
Rho Family GTPases
.61
MAPK Signaling
.58
Molecular Mechanisms of Cancer
.51
ILK Signaling
.49
4 Glioma
Glioma
.49
Melanoma
.46
Signaling Pathways in Glioblastoma
.32
Endocrine resistance
.31
5 Nanog in Mammalian ESC Pluripotency
GSK3 Signaling
.62
Nanog in Mammalian ESC Pluripotency
.62
14-3-3 Induced Intracellular Signaling
.59
eNOS Signaling
.48
genes like me logo Genes that share pathways with IGF1R: view

Pathways by source for IGF1R Gene

3 Sino Biological pathways for IGF1R Gene
13 GeneGo (Thomson Reuters) pathways for IGF1R Gene
  • Apoptosis and survival BAD phosphorylation
  • Apoptosis and survival Caspase cascade
  • Apoptosis and survival_Regulation of Apoptosis by Mitochondrial Proteins
  • Cell adhesion_ECM remodeling
  • Development IGF-1 receptor signaling
3 R&D Systems pathways for IGF1R Gene
61 Qiagen pathways for IGF1R Gene
  • 14-3-3 Induced Intracellular Signaling
  • Actin Nucleation and Branching
  • Actin Nucleation by ARP-WASP Complex
  • Actin-Based Motility by Rho Family GTPases
  • Activation of cAMP-Dependent PKA
2 Cell Signaling Technology pathways for IGF1R Gene

SIGNOR curated interactions for IGF1R Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for IGF1R Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0006955 immune response IMP 16886151
GO:0007165 signal transduction TAS 3003744
GO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway IEA,IBA 21873635
GO:0007275 multicellular organism development IBA 21873635
genes like me logo Genes that share ontologies with IGF1R: view

Drugs & Compounds for IGF1R Gene

Products:

  1. Drug

(142) Drugs for IGF1R Gene - From: DrugBank, ClinicalTrials, ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Mecasermin Approved, Investigational Pharma Target, agonist, inhibitor 36
Paclitaxel Approved, Vet_approved Pharma Tubulin and Bcl2 inhibitor, Taxanes 3701
brigatinib Approved, Investigational Pharma Target, inhibitor 0
Insulin aspart Approved Pharma Target 544
Insulin degludec Approved Pharma Target 0

(54) Additional Compounds for IGF1R Gene - From: HMDB, Novoseek, IUPHAR, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
IGF1
IGF2
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
 Agonist, Full agonist, Partial agonist, Gating inhibitor, Antagonist 58-64-0
GSK 1838705
1116235-97-2
Insulin (human) recombinant
11061-68-0

(5) Tocris Compounds for IGF1R Gene

Compound Action Cas Number
Demethylasterriquinone B1 Selective insulin RTK activator 78860-34-1
GSK 1838705 Potent IR and IGF1R inhibitor; also inhibits anaplastic lymphoma kinase (ALK) 1116235-97-2
Insulin (human) recombinant Endogenous peptide agonist 11061-68-0
Picropodophyllotoxin Selective IGF1R inhibitor 477-47-4
PQ 401 IGF1R inhibitor 196868-63-0

(14) ApexBio Compounds for IGF1R Gene

Compound Action Cas Number
AG-1024 Selective IGF-1R inhibitor 65678-07-1
AXL1717 IGF-1R inhibitor,orally active 477-47-4
AZD-3463 ALK/IGF1R inhibitor 1356962-20-3
BMS-536924 IR/IGF-1R inhibitor 468740-43-4
BMS-754807 IGF-1R/InsR inhibitor,potent and selective 1001350-96-4
GSK1838705A IGF-IR/IR/ALK inhibitor, ATP-competitive 1116235-97-2
GSK1904529A Selective IGF-1R/IR inhibitor 1089283-49-7
Linsitinib IGF1R/IR inhibitor,potent and novel 867160-71-2
MK 0893 Glucagon receptor/IGF-1R antagonist 870823-12-4
NVP-ADW742 Selective IGF-1R inhibitor 475488-23-4
NVP-AEW541 IGF-IR inhibitor, novel, potent and selective 475489-16-8
PQ 401 IGF1R inhibitor,potent and cell-permeable 196868-63-0
TAE226 (NVP-TAE226) FAK inhibitor,potent and ATP-competitive 761437-28-9
XL228 IGF1R/AURORA /FGFR1-3/ABL/SRC family kinases inhibitor 898280-07-4
genes like me logo Genes that share compounds with IGF1R: view

Transcripts for IGF1R Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone

mRNA/cDNA for IGF1R Gene

3 REFSEQ mRNAs :
21 NCBI additional mRNA sequence :
17 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for IGF1R

Alternative Splicing Database (ASD) splice patterns (SP) for IGF1R Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10a · 10b · 10c · 10d ^ 11a · 11b · 11c ^ 12 ^ 13 ^ 14 ^ 15a · 15b ^ 16 ^ 17a · 17b ^ 18 ^ 19a ·
SP1: - - - - - - - - -
SP2:
SP3: - - -
SP4: - - - -
SP5:
SP6: - - - - -
SP7: - -
SP8: -
SP9:
SP10:
SP11:
SP12:

ExUns: 19b ^ 20 ^ 21 ^ 22 ^ 23 ^ 24 ^ 25 ^ 26a · 26b ^ 27 ^ 28 ^ 29 ^ 30a · 30b
SP1: -
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:

Relevant External Links for IGF1R Gene

GeneLoc Exon Structure for
IGF1R

Expression for IGF1R Gene

Products:

  1. Primer
  2. Gene Expression Assay

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for IGF1R Gene

mRNA expression in normal human tissues for IGF1R Gene
mRNA expression by BioGPS for IGF1R GenemRNA expression by GTEx for IGF1R Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for IGF1R Gene

This gene is overexpressed in Fetal Brain (13.5), Bone (11.7), Retina (6.6), Lung (6.4), and Testis (6.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for IGF1R Gene



Protein tissue co-expression partners for IGF1R Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for IGF1R

SOURCE GeneReport for Unigene cluster for IGF1R Gene:

Hs.643120

mRNA Expression by UniProt/SwissProt for IGF1R Gene:

P08069-IGF1R_HUMAN
Tissue specificity: Found as a hybrid receptor with INSR in muscle, heart, kidney, adipose tissue, skeletal muscle, hepatoma, fibroblasts, spleen and placenta (at protein level). Expressed in a variety of tissues. Overexpressed in tumors, including melanomas, cancers of the colon, pancreas prostate and kidney.

Evidence on tissue expression from TISSUES for IGF1R Gene

  • Nervous system(4.8)
  • Skin(4.6)
  • Pancreas(3.8)
  • Intestine(3.3)
  • Lung(3.3)
  • Muscle(3.3)
  • Kidney(3.2)
  • Liver(3.2)
  • Heart(3.1)
  • Blood(3.1)
  • Thyroid gland(2.8)
  • Bone marrow(2.7)
  • Eye(2.7)
  • Adrenal gland(2.7)
  • Lymph node(2.6)
  • Stomach(2.5)
  • Spleen(2.5)
  • Bone(2.4)

Phenotype-based relationships between genes and organs from Gene ORGANizer for IGF1R Gene

Germ Layers:
  • ectoderm
  • mesoderm
Systems:
  • integumentary
  • nervous
  • skeletal muscle
  • skeleton
Regions:
Head and neck:
  • brain
  • face
  • head
  • jaw
  • lip
  • mandible
  • maxilla
  • mouth
  • neck
  • nose
  • skull
Thorax:
  • breast
  • chest wall
  • clavicle
  • rib
  • rib cage
  • scapula
  • sternum
Pelvis:
  • pelvis
Limb:
  • ankle
  • arm
  • digit
  • elbow
  • femur
  • fibula
  • finger
  • foot
  • forearm
  • hand
  • hip
  • humerus
  • knee
  • lower limb
  • radius
  • shin
  • shoulder
  • thigh
  • tibia
  • toe
  • ulna
  • upper limb
  • wrist
General:
  • skin
  • spinal column
  • vertebrae
genes like me logo Genes that share expression patterns with IGF1R: view

No data available for mRNA differential expression in normal tissues for IGF1R Gene

Orthologs for IGF1R Gene

This gene was present in the common ancestor of animals.

Orthologs for IGF1R Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
 Mammalia IGF1R 30 31
  • 99.49 (n)
 OneToOne
Cow
(Bos Taurus)
 Mammalia IGFR1 31
  • 98 (a)
 OneToOne
IGF1R 30
  • 91.44 (n)
Dog
(Canis familiaris)
 Mammalia IGF1R 30 31
  • 91.68 (n)
 OneToOne
Mouse
(Mus musculus)
 Mammalia Igf1r 30 17 31
  • 89.56 (n)
 OneToOne
Rat
(Rattus norvegicus)
 Mammalia Igf1r 30
  • 89.35 (n)
Oppossum
(Monodelphis domestica)
 Mammalia IGF1R 31
  • 89 (a)
 OneToOne
Platypus
(Ornithorhynchus anatinus)
 Mammalia IGF1R 31
  • 67 (a)
 OneToOne
Chicken
(Gallus gallus)
 Aves IGF1R 30 31
  • 79.45 (n)
 OneToOne
Lizard
(Anolis carolinensis)
 Reptilia IGF1R 31
  • 80 (a)
 OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
 Amphibia igf1r 30
  • 72.12 (n)
Str.14302 30
African clawed frog
(Xenopus laevis)
 Amphibia LOC398022 30
Zebrafish
(Danio rerio)
 Actinopterygii igf1ra 30 31
  • 68.51 (n)
 OneToMany
igf1rb 31
  • 64 (a)
 OneToMany
Fruit Fly
(Drosophila melanogaster)
 Insecta InR 30 32
  • 50.34 (n)
sev 32
  • 49 (a)
hop 32
  • 34 (a)
CG3837 31 32
  • 28 (a)
 OneToMany
CG10702 32
  • 26 (a)
African malaria mosquito
(Anopheles gambiae)
 Insecta INR 30
  • 50.28 (n)
Worm
(Caenorhabditis elegans)
 Secernentea daf-2 30 31 32
  • 45.03 (n)
 OneToMany
R151.4 32
  • 38 (a)
K09B11.5 32
  • 35 (a)
W02A2.4 32
  • 34 (a)
C24G6.2a 32
  • 34 (a)
C24G6.2b 32
  • 34 (a)
T25B9.5 32
  • 32 (a)
Y69E1A.3 32
  • 32 (a)
Sea Squirt
(Ciona savignyi)
 Ascidiacea -- 31
  • 38 (a)
 OneToMany
Sea Vase
(Ciona intestinalis)
 Ascidiacea Cin.344 30
Species where no ortholog for IGF1R was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for IGF1R Gene

ENSEMBL:
Gene Tree for IGF1R (if available)
TreeFam:
Gene Tree for IGF1R (if available)
Aminode:
Evolutionary constrained regions (ECRs) for IGF1R: view image

Paralogs for IGF1R Gene

Paralogs for IGF1R Gene

(27) SIMAP similar genes for IGF1R Gene using alignment to 7 proteins:

  • IGF1R_HUMAN
  • C9J5X1_HUMAN
  • H0YLE7_HUMAN
  • H0YMJ5_HUMAN
  • H0YNR0_HUMAN
  • H3BSZ8_HUMAN
  • Q3B833_HUMAN