Aliases for IGF1R Gene
Aliases for IGF1R Gene
External Ids for IGF1R Gene
- HGNC: 5465
- Entrez Gene: 3480
- Ensembl: ENSG00000140443
- OMIM: 147370
- UniProtKB: P08069
Previous GeneCards Identifiers for IGF1R Gene
- GC15P095878
- GC15P093033
- GC15P096785
- GC15P096928
- GC15P097010
- GC15P099192
- GC15P075320
Summaries for IGF1R Gene
-
This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]
GeneCards Summary for IGF1R Gene
IGF1R (Insulin Like Growth Factor 1 Receptor) is a Protein Coding gene. Diseases associated with IGF1R include Insulin-Like Growth Factor I and Ring Chromosome 15. Among its related pathways are Apoptotic Pathways in Synovial Fibroblasts and NFAT and Cardiac Hypertrophy. Gene Ontology (GO) annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is INSR.
UniProtKB/Swiss-Prot for IGF1R Gene
-
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway and the Ras-MAPK pathway. The result of activating the MAPK pathway is increased cellular proliferation, whereas activating the PI3K pathway inhibits apoptosis and stimulates protein synthesis. Phosphorylated IRS1 can activate the 85 kDa regulatory subunit of PI3K (PIK3R1), leading to activation of several downstream substrates, including protein AKT/PKB. AKT phosphorylation, in turn, enhances protein synthesis through mTOR activation and triggers the antiapoptotic effects of IGFIR through phosphorylation and inactivation of BAD. In parallel to PI3K-driven signaling, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc leads to recruitment of Ras and activation of the ras-MAPK pathway. In addition to these two main signaling pathways IGF1R signals also through the Janus kinase/signal transducer and activator of transcription pathway (JAK/STAT). Phosphorylation of JAK proteins can lead to phosphorylation/activation of signal transducers and activators of transcription (STAT) proteins. In particular activation of STAT3, may be essential for the transforming activity of IGF1R. The JAK/STAT pathway activates gene transcription and may be responsible for the transforming activity. JNK kinases can also be activated by the IGF1R. IGF1 exerts inhibiting activities on JNK activation via phosphorylation and inhibition of MAP3K5/ASK1, which is able to directly associate with the IGF1R.
-
When present in a hybrid receptor with INSR, binds IGF1. PubMed:12138094 shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, PubMed:16831875 shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.
-
Insulin receptors (IRs) and insulin-like growth factor receptors (IGFRs) are formed from two subunits, each of which is comprised of an extracellular alpha-subunit and a transmembrane beta-subunit with intracellular tyrosine kinase activity. IR homodimers are activated by insulin.
Additional gene information for IGF1R Gene
- Monarch Initiative
- Search for IGF1R at DataMed
- Search for IGF1R at HumanCyc
No data available for PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for IGF1R Gene
Genomics for IGF1R Gene
GeneHancer (GH) Regulatory Elements for IGF1R Gene
Promoters and enhancers for IGF1R Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around IGF1R on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Locations for IGF1R Gene
Genomic Locations for IGF1R Gene
- chr15:98,648,539-98,964,530
- (GRCh38/hg38)
- Size:
- 315,992 bases
- Orientation:
- Plus strand
- chr15:99,192,200-99,507,759
- (GRCh37/hg19)
Genomic View for IGF1R Gene
Genes around IGF1R on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 15q26.3 by Ensembl
- 15q26.3 by Entrez Gene
- 15q26.3 by HGNC
IGF1R Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for IGF1R Gene
Proteins for IGF1R Gene
-
Protein details for IGF1R Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P08069-IGF1R_HUMAN
- Recommended name:
- Insulin-like growth factor 1 receptor
- Protein Accession:
- P08069
- B1B5Y2
- Q14CV2
- Q9UCC0
Protein attributes for IGF1R Gene
- Size:
- 1367 amino acids
- Molecular mass:
- 154793 Da
- Quaternary structure:
-
- Tetramer of 2 alpha and 2 beta chains linked by disulfide bonds. The alpha chains contribute to the formation of the ligand-binding domain, while the beta chain carries the kinase domain. Interacts with PIK3R1 and with the PTB/PID domains of IRS1 and SHC1 in vitro when autophosphorylated on tyrosine residues. Forms a hybrid receptor with INSR, the hybrid is a tetramer consisting of 1 alpha chain and 1 beta chain of INSR and 1 alpha chain and 1 beta chain of IGF1R. Interacts with ARRB1 and ARRB2. Interacts with GRB10. Interacts with RACK1. Interacts with SOCS1, SOCS2 and SOCS3. Interacts with 14-3-3 proteins. Interacts with NMD2. Interacts with MAP3K5. Interacts with STAT3. Found in a ternary complex with IGF1 and ITGAV:ITGB3 or ITGA6:ITGB4 (PubMed:19578119, PubMed:22351760).
- SequenceCaution:
-
- Sequence=BAG11657.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Protein Expression for IGF1R Gene
Selected DME Specific Peptides for IGF1R Gene
- P08069:
-
- DGQDACG
- LMRMCWQ
- IGLYNLRNITRGA
- LENCTVIEG
- PESLKDG
- RDLAARN
- YALVIFEM
- YVPDEWEV
- AIKTVNE
- FPNLTVI
- GVVSQGQPT
- GLLPVRWM
- MCWQYNPKMRP
- SASNSSSQL
- GVVLWEI
- GPGVLVLRASFDERQPYAHMNGGR
- RERIEFLNEASVMK
- RYRPPDYRDLISFTVYYKEAPF
- FGMVYEG
- FNCHHVV
- AKGVVKDE
- RLGNGVLYASVNPEYFSAA
- MEEVTGTKGRQ
- KTIDSVTSAQ
- KFVHRDLAARNCMV
- HVVRLLGV
- ERTVISNL
- SNEQVLRFVMEGGLL
- PVRWMSPE
- VTGYVKIRHSHALVSLSFLK
- CCHPECLGSC
- PNGLILMYEI
- EAEYRKVFENFLHNSIFVPRP
- NNYIVGNKPPKEC
- LKPWTQYA
- PFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPA
- PCEGPCPK
- DGMAYLNA
- CACPKTEAE
- EIADGMAYL
- FVHRDLA
- QPYQGLSNE
- GPCPKVC
Post-translational modifications for IGF1R Gene
- Autophosphorylated on tyrosine residues in response to ligand binding. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit. Autophosphorylation occurs in a sequential manner; Tyr-1165 is predominantly phosphorylated first, followed by phosphorylation of Tyr-1161 and Tyr-1166. While every single phosphorylation increases kinase activity, all three tyrosine residues in the kinase activation loop (Tyr-1165, Tyr-1161 and Tyr-1166) have to be phosphorylated for optimal activity. Can be autophosphorylated at additional tyrosine residues (in vitro). Autophosphorylated is followed by phosphorylation of juxtamembrane tyrosines and C-terminal serines. Phosphorylation of Tyr-980 is required for IRS1- and SHC1-binding. Phosphorylation of Ser-1278 by GSK-3beta restrains kinase activity and promotes cell surface expression, it requires a priming phosphorylation at Ser-1282. Dephosphorylated by PTPN1 (By similarity).
- Controlled by regulated intramembrane proteolysis (RIP). Undergoes metalloprotease-dependent constitutive ectodomain shedding to produce a membrane-anchored 52 kDa C-Terminal fragment which is further processed by presenilin gamma-secretase to yield an intracellular 50 kDa fragment.
- Polyubiquitinated at Lys-1168 and Lys-1171 through both Lys-48 and Lys-29 linkages, promoting receptor endocytosis and subsequent degradation by the proteasome. Ubiquitination is facilitated by pre-existing phosphorylation.
- Sumoylated with SUMO1.
- Ubiquitination at posLast=10331033, posLast=11681168, and posLast=11711171
- Glycosylation at isoforms=51, isoforms=102, isoforms=135, posLast=244244, isoforms=314, posLast=417417, posLast=438438, posLast=534534, posLast=607607, posLast=622622, posLast=640640, isoforms=747, isoforms=756, isoforms=764, isoforms=900, and posLast=913913
Other Protein References for IGF1R Gene
Antibody Products
- R&D Systems Antibodies for IGF1R (IGF-I R)
- Cell Signaling Technology (CST) Antibodies for IGF1R (IGF1R)
-
Custom Antibody ServicesOriGene Antibodies for IGF1R
- CF807836
- TA807836
- CF807835
- TA807835
- TA590052
- TA333218
- TA333217
- TA327789
- TA325553
- TA325552
- TA325551
- TA325550
- TA325549
- TA321220
- TA321219
- TA311816
- TA311815
- TA310056
- TA309975
- TA309698
- BM2226RT
- BM2226R
- BM2226PT
- BM2226P
- BM2226LE
- AP55741PU-S
- AP55741PU-N
- AP55027SU-N
- AP26038PU-S
- AP26038PU-N
- AP20951PU-N
- AP14361PU-N
- AP08068PU-S
- AP08068PU-N
- AP06178PU-N
- AP06177PU-N
- AP02787PU-S
- AP02787PU-N
- AP02621PU-S
- AP02621PU-N
- AP02620PU-S
- AP02620PU-N
- AP02386PU-S
- AP02386PU-N
- AP01611PU-N
- AP01610PU-N
- AM20501PU-N
- AM06184SU-N
- AM06175SU-N
- AM00072PU-N
- AM00072BT-N
- AM00071PU-N
- Novus Biologicals Antibodies for IGF1R
-
Abcam antibodies for IGF1R
-
Cloud-Clone Corp. Antibodies for IGF1R
- Invitrogen Antibodies for IGF1R
- antibodies-online: Search results for 494 available IGF1R Antibodies ranked by validation data
- Compare Top IGF1R Antibodies
-
Recommended
- 1 ICS Antibody (anti-mouse)
- 2 FACS Antibodies (anti-mouse)
- 6 IHC (p) Antibodies (anti-mouse)
- 9 IHC Antibodies (anti-mouse)
- 96 IF (p) Antibodies (anti-mouse)
- 128 WB Antibodies (anti-mouse)
- 1 ICS Antibody (anti-rat)
- 2 FACS Antibodies (anti-rat)
- 6 IHC (p) Antibodies (anti-rat)
- 9 IHC Antibodies (anti-rat)
- 96 IF (p) Antibodies (anti-rat)
- 116 WB Antibodies (anti-rat)
- 1 ICS Antibody (anti-human)
- 1 IF/ICC Antibody (anti-human)
- 1 IF Antibody (anti-human)
- 1 EIA Antibody (anti-human)
- 1 CC Antibody (anti-human)
- 10 IP Antibodies (anti-human)
- 11 IHC (p) Antibodies (anti-human)
- 13 IHC Antibodies (anti-human)
- 19 FACS Antibodies (anti-human)
- 96 IF (p) Antibodies (anti-human)
- 310 WB Antibodies (anti-human)
- GeneTex IGF1R antibody for IGF1R
-
Custom Antibody ServicesProSci Antibodies for IGF1R
-
Santa Cruz Biotechnology (SCBT) Antibodies for IGF1R
- Sino Biological Antibodies for IGF1R
Protein Products
- R&D Systems Proteins and Enzymes for IGF1R (IGF-I R)
- Search Origene for MassSpec and Protein Over-expression Lysates for IGF1R
- Origene Custom Protein Services for IGF1R
- Sino Biological Cell Lysates for IGF1R
- Sino Biological Recombinant Proteins for IGF1R
-
Cloud-Clone Corp. Proteins for IGF1R
- Search GeneTex for Proteins for IGF1R
-
Abcam proteins for IGF1R
Assay Products
-
Custom Assay ServicesOriGene ELISA Kits for IGF1R
- R&D Systems Proteome Profiler Antibody Arrays, ELISAs, and other biochemical assays for IGF1R (IGF-I R)
- Novus Biologicals ELISA Kits for IGF1R
- Cell Signaling Technology (CST) Sandwich ELISA Kits for IGF1R (IGF1R)
-
Cloud-Clone Corp. Assay Kits for IGF1R
- Sino Biological Assays for IGF1R
Domains & Families for IGF1R Gene
Gene Families for IGF1R Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Cancer-related genes
- CD markers
- Disease related genes
- Enzymes
- FDA approved drug targets
- Plasma proteins
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for IGF1R Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for IGF1R Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P08069UniProtKB/Swiss-Prot:
IGF1R_HUMAN :- Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
Function for IGF1R Gene
Molecular function for IGF1R Gene
- GENATLAS Biochemistry:
- insulin-like growth factor 1,receptor
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Activated by autophosphorylation at Tyr-1165, Tyr-1161 and Tyr-1166 on the kinase activation loop; phosphorylation at all three tyrosine residues is required for optimal kinase activity. Inhibited by MSC1609119A-1, BMS-754807, PQIP, benzimidazole pyridinone, isoquinolinedione, bis-azaindole, 3-cyanoquinoline, 2,4-bis-arylamino-1,3-pyrimidine, pyrrolopyrimidine, pyrrole-5-carboxaldehyde, picropodophyllin (PPP), tyrphostin derivatives. While most inhibitors bind to the ATP binding pocket, MSC1609119A-1 functions as allosteric inhibitor and binds close to the DFG motif and the activation loop.
- UniProtKB/Swiss-Prot Function:
- Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway and the Ras-MAPK pathway. The result of activating the MAPK pathway is increased cellular proliferation, whereas activating the PI3K pathway inhibits apoptosis and stimulates protein synthesis. Phosphorylated IRS1 can activate the 85 kDa regulatory subunit of PI3K (PIK3R1), leading to activation of several downstream substrates, including protein AKT/PKB. AKT phosphorylation, in turn, enhances protein synthesis through mTOR activation and triggers the antiapoptotic effects of IGFIR through phosphorylation and inactivation of BAD. In parallel to PI3K-driven signaling, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc leads to recruitment of Ras and activation of the ras-MAPK pathway. In addition to these two main signaling pathways IGF1R signals also through the Janus kinase/signal transducer and activator of transcription pathway (JAK/STAT). Phosphorylation of JAK proteins can lead to phosphorylation/activation of signal transducers and activators of transcription (STAT) proteins. In particular activation of STAT3, may be essential for the transforming activity of IGF1R. The JAK/STAT pathway activates gene transcription and may be responsible for the transforming activity. JNK kinases can also be activated by the IGF1R. IGF1 exerts inhibiting activities on JNK activation via phosphorylation and inhibition of MAP3K5/ASK1, which is able to directly associate with the IGF1R.
- UniProtKB/Swiss-Prot Function:
- When present in a hybrid receptor with INSR, binds IGF1. PubMed:12138094 shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, PubMed:16831875 shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.
Enzyme Numbers (IUBMB) for IGF1R Gene
Phenotypes From GWAS Catalog for IGF1R Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004672 | protein kinase activity | IEA | -- |
| GO:0004713 | protein tyrosine kinase activity | TAS,IEA | -- |
| GO:0004714 | transmembrane receptor protein tyrosine kinase activity | IEA | -- |
| GO:0005010 | insulin-like growth factor-activated receptor activity | IDA | 7679099 |
| GO:0005158 | insulin receptor binding | IDA | 8452530 |
Phenotypes for IGF1R Gene
- MGI mutant phenotypes for IGF1R:
-
inferred from 8 alleles
- nervous system phenotype
- homeostasis/metabolism phenotype
- respiratory system phenotype
- muscle phenotype
- cardiovascular system phenotype
- mortality/aging
- immune system phenotype
- cellular phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- neoplasm
- digestive/alimentary phenotype
- endocrine/exocrine gland phenotype
- reproductive system phenotype
- hearing/vestibular/ear phenotype
- integument phenotype
- embryo phenotype
- hematopoietic system phenotype
- skeleton phenotype
- liver/biliary system phenotype
- craniofacial phenotype
- adipose tissue phenotype
- limbs/digits/tail phenotype
- GenomeRNAi human phenotypes for IGF1R:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased viability in esophageal squamous lineage
- Decreased ionizing radiation sensitivity
- Increased shRNA abundance (Z-score > 2)
- Decreased shRNA abundance (Z-score < -2)
- Decreased viability
- Decreased substrate adherent cell growth
- Decreased IL-8 secretion
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Decreased focal adhesion (FA) area, decreased FA length, decreased FA mean intensity, increased number of small and round FAs, increased FA abundance
- Decreased cell migration
- Increased cell death HMECs cells
- Weakly decreased NFAT1-GFP nuclear translocation
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Increased cell viability after pRB stimulation
- Condensed cis-Golgi
- Increased colony dispersion (increased number of colonies and decreased number of cells per colony)
- Decreased Cdk9 T-loop phosphorylation
Animal Models for IGF1R Gene
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for IGF1R
-
-
ViGene Biosciences lentiviral particle packaged cDNA for IGF1R gene
-
ViGene Biosciences ready-to-package AAV shRNAs for IGF1R gene
- Search ViGene Biosciences for IGF1R
CRISPR Products
-
OriGene CRISPR knockouts for IGF1R
- genomics-online: gRNA clones - Search results for 140 available IGF1R gene related products
- Overview of 140 available IGF1R gene related products
- Applied Biological Materials CRISPR for IGF1R
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for IGF1R
- GenScript: Design CRISPR guide RNA sequences for IGF1R
miRNA for IGF1R Gene
- miRTarBase miRNAs that target IGF1R
-
- hsa-mir-122-5p (MIRT000364)
- hsa-mir-133b (MIRT004460)
- hsa-mir-145-5p (MIRT004931)
- hsa-mir-7-5p (MIRT005364)
- hsa-mir-138-5p (MIRT005691)
- hsa-mir-194-5p (MIRT005892)
- hsa-mir-99a-5p (MIRT006145)
- hsa-mir-223-3p (MIRT006244)
- hsa-mir-100-5p (MIRT006429)
- hsa-mir-497-5p (MIRT006785)
- hsa-mir-152-3p (MIRT006861)
- hsa-mir-139-5p (MIRT006942)
- hsa-mir-376c-3p (MIRT006964)
- hsa-mir-376a-3p (MIRT006965)
- hsa-mir-181b-5p (MIRT007239)
- hsa-mir-383-5p (MIRT007246)
- hsa-mir-335-5p (MIRT018536)
- hsa-mir-215-5p (MIRT024453)
- hsa-mir-183-5p (MIRT025009)
- hsa-mir-182-5p (MIRT025033)
- hsa-mir-196a-5p (MIRT026064)
- hsa-mir-192-5p (MIRT026729)
- hsa-mir-30a-5p (MIRT028606)
- hsa-let-7d-5p (MIRT032181)
- hsa-mir-1226-3p (MIRT036409)
- hsa-mir-484 (MIRT041856)
- hsa-mir-320a (MIRT044504)
- hsa-mir-34a-5p (MIRT047346)
- hsa-mir-92a-3p (MIRT049840)
- hsa-let-7e-5p (MIRT051489)
- hsa-mir-125b-2-3p (MIRT053086)
- hsa-let-7c-5p (MIRT053087)
- hsa-mir-16-5p (MIRT053088)
- hsa-mir-630 (MIRT053232)
- bta-mir-223 (MIRT054013)
- hsa-let-7b-5p (MIRT054075)
- hsa-mir-143-3p (MIRT054257)
- hsa-mir-133a-3p (MIRT054310)
- hsa-mir-140-5p (MIRT054456)
- hsa-mir-150-3p (MIRT054481)
- hsa-mir-375 (MIRT054558)
- hsa-mir-511-3p (MIRT073626)
- hsa-mir-548n (MIRT073628)
- hsa-mir-548t-5p (MIRT073629)
- hsa-mir-3609 (MIRT073630)
- hsa-mir-548ah-5p (MIRT073631)
- hsa-mir-548at-5p (MIRT073633)
- hsa-mir-548az-5p (MIRT073634)
- hsa-let-7a-2-3p (MIRT073635)
- hsa-let-7g-3p (MIRT073638)
- hsa-mir-503-5p (MIRT073642)
- hsa-mir-4670-3p (MIRT073657)
- hsa-mir-583 (MIRT073659)
- hsa-mir-885-5p (MIRT073660)
- hsa-mir-4668-5p (MIRT073662)
- hsa-mir-6124 (MIRT073666)
- hsa-mir-7151-5p (MIRT073667)
- hsa-let-7a-5p (MIRT073668)
- hsa-let-7f-5p (MIRT073669)
- hsa-mir-33a-3p (MIRT073670)
- hsa-mir-98-5p (MIRT073671)
- hsa-let-7g-5p (MIRT073672)
- hsa-let-7i-5p (MIRT073673)
- hsa-mir-577 (MIRT073676)
- hsa-mir-1294 (MIRT073677)
- hsa-mir-3927-3p (MIRT073679)
- hsa-mir-3935 (MIRT073680)
- hsa-mir-4458 (MIRT073682)
- hsa-mir-4500 (MIRT073683)
- hsa-mir-5586-3p (MIRT073686)
- hsa-mir-6740-5p (MIRT073687)
- hsa-mir-6831-5p (MIRT073688)
- hsa-mir-1275 (MIRT115349)
- hsa-mir-4665-5p (MIRT115350)
- hsa-mir-3919 (MIRT115385)
- hsa-mir-8485 (MIRT115388)
- hsa-mir-625-5p (MIRT194390)
- hsa-mir-3148 (MIRT194391)
- hsa-mir-4641 (MIRT233689)
- hsa-mir-4710 (MIRT233694)
- hsa-mir-4792 (MIRT233696)
- hsa-mir-302a-3p (MIRT242360)
- hsa-mir-302b-3p (MIRT242361)
- hsa-mir-302c-3p (MIRT242362)
- hsa-mir-302d-3p (MIRT242363)
- hsa-mir-372-3p (MIRT242364)
- hsa-mir-373-3p (MIRT242365)
- hsa-mir-520e (MIRT242366)
- hsa-mir-520a-3p (MIRT242368)
- hsa-mir-520b (MIRT242370)
- hsa-mir-520c-3p (MIRT242371)
- hsa-mir-520d-3p (MIRT242372)
- hsa-mir-1253 (MIRT242374)
- hsa-mir-302e (MIRT242375)
- hsa-mir-4299 (MIRT242376)
- hsa-mir-3646 (MIRT242377)
- hsa-mir-3662 (MIRT242378)
- hsa-mir-6770-5p (MIRT242379)
- hsa-mir-7855-5p (MIRT242380)
- hsa-mir-99b-5p (MIRT250248)
- hsa-mir-378a-3p (MIRT250249)
- hsa-mir-224-3p (MIRT282578)
- hsa-mir-522-3p (MIRT282579)
- hsa-mir-1468-3p (MIRT282580)
- hsa-mir-885-3p (MIRT282582)
- hsa-mir-3613-3p (MIRT282595)
- hsa-mir-190a-3p (MIRT282600)
- hsa-mir-1277-5p (MIRT282601)
- hsa-mir-5011-5p (MIRT282602)
- hsa-mir-548d-3p (MIRT282615)
- hsa-mir-548h-3p (MIRT282616)
- hsa-mir-548z (MIRT282617)
- hsa-mir-548ac (MIRT282618)
- hsa-mir-548as-3p (MIRT282619)
- hsa-mir-548bb-3p (MIRT282620)
- hsa-mir-5681a (MIRT282626)
- hsa-mir-34a-3p (MIRT282629)
- hsa-mir-539-5p (MIRT282630)
- hsa-mir-1827 (MIRT282632)
- hsa-mir-1910-3p (MIRT282633)
- hsa-mir-3617-3p (MIRT282636)
- hsa-mir-6511a-5p (MIRT282637)
- hsa-mir-8060 (MIRT282638)
- hsa-mir-96-5p (MIRT282640)
- hsa-mir-1271-5p (MIRT282641)
- hsa-mir-3125 (MIRT343108)
- hsa-mir-3916 (MIRT343109)
- hsa-mir-6859-5p (MIRT343110)
- hsa-mir-592 (MIRT343111)
- hsa-mir-597-5p (MIRT343112)
- hsa-mir-520a-5p (MIRT343114)
- hsa-mir-525-5p (MIRT343115)
- hsa-mir-2467-3p (MIRT343119)
- hsa-mir-185-5p (MIRT437483)
- hsa-mir-206 (MIRT438356)
- hsa-mir-21-5p (MIRT438483)
- hsa-mir-26b-5p (MIRT438484)
- hsa-mir-486-5p (MIRT438711)
- hsa-mir-218-5p (MIRT440464)
- hsa-mir-4535 (MIRT475250)
- hsa-mir-4800-5p (MIRT475251)
- hsa-mir-8071 (MIRT475252)
- hsa-mir-6745 (MIRT475253)
- hsa-mir-363-5p (MIRT475254)
- hsa-mir-8085 (MIRT475255)
- hsa-mir-3175 (MIRT475256)
- hsa-mir-6731-5p (MIRT475257)
- hsa-mir-659-5p (MIRT475258)
- hsa-mir-492 (MIRT475259)
- hsa-mir-6861-3p (MIRT475260)
- hsa-mir-6804-5p (MIRT475261)
- hsa-mir-5572 (MIRT485472)
- hsa-mir-4260 (MIRT485473)
- hsa-mir-450a-2-3p (MIRT485474)
- hsa-mir-6803-5p (MIRT485475)
- hsa-mir-6751-5p (MIRT485476)
- hsa-mir-7109-5p (MIRT485477)
- hsa-mir-4789-5p (MIRT485478)
- hsa-mir-466 (MIRT485479)
- hsa-mir-5010-5p (MIRT485480)
- hsa-mir-4525 (MIRT485481)
- hsa-mir-7111-5p (MIRT485482)
- hsa-mir-6870-5p (MIRT485483)
- hsa-mir-5698 (MIRT485484)
- hsa-mir-4723-5p (MIRT485485)
- hsa-mir-202-3p (MIRT485486)
- hsa-mir-3163 (MIRT485487)
- hsa-mir-4643 (MIRT485488)
- hsa-mir-4789-3p (MIRT485489)
- hsa-mir-340-5p (MIRT502190)
- hsa-mir-4539 (MIRT502191)
- hsa-mir-3200-5p (MIRT502192)
- hsa-mir-7161-5p (MIRT502193)
- hsa-mir-548u (MIRT502194)
- hsa-mir-3191-5p (MIRT536713)
- hsa-mir-6873-3p (MIRT536714)
- hsa-mir-7978 (MIRT536715)
- hsa-mir-494-3p (MIRT536716)
- hsa-mir-4456 (MIRT536717)
- hsa-mir-548q (MIRT536718)
- hsa-mir-6824-3p (MIRT536719)
- hsa-mir-6764-3p (MIRT536720)
- hsa-mir-518c-5p (MIRT536721)
- hsa-mir-6817-3p (MIRT536722)
- hsa-mir-7110-3p (MIRT536723)
- hsa-mir-4423-3p (MIRT547841)
- hsa-mir-449c-5p (MIRT547842)
- hsa-mir-34b-5p (MIRT547843)
- hsa-mir-2682-5p (MIRT547844)
- hsa-mir-940 (MIRT547845)
- hsa-mir-6893-5p (MIRT547846)
- hsa-mir-6808-5p (MIRT547847)
- hsa-mir-551b-5p (MIRT556952)
- hsa-mir-548c-3p (MIRT556953)
- hsa-mir-675-3p (MIRT556954)
- hsa-mir-223-5p (MIRT556955)
- hsa-mir-7157-5p (MIRT567210)
- hsa-mir-4310 (MIRT567211)
- hsa-mir-4655-5p (MIRT567212)
- hsa-mir-224-5p (MIRT567213)
- hsa-mir-502-5p (MIRT612880)
- hsa-mir-3941 (MIRT612881)
- hsa-mir-3124-3p (MIRT612882)
- hsa-mir-603 (MIRT612883)
- hsa-mir-362-3p (MIRT612884)
- hsa-mir-329-3p (MIRT612885)
- hsa-mir-4433b-5p (MIRT623628)
- hsa-mir-203a-3p (MIRT623629)
- hsa-mir-6794-3p (MIRT623630)
- hsa-mir-377-3p (MIRT623631)
- hsa-mir-4433a-5p (MIRT623632)
- hsa-mir-342-3p (MIRT623633)
- hsa-mir-6884-3p (MIRT623634)
- hsa-mir-4639-3p (MIRT623635)
- hsa-mir-4511 (MIRT623636)
- hsa-mir-629-3p (MIRT657211)
- hsa-mir-3180-5p (MIRT657212)
- hsa-mir-488-5p (MIRT657213)
- hsa-mir-7161-3p (MIRT657214)
- hsa-mir-6738-3p (MIRT702751)
- hsa-mir-544a (MIRT702752)
- hsa-mir-5001-3p (MIRT702753)
- hsa-mir-4727-5p (MIRT702754)
- hsa-mir-570-3p (MIRT702755)
- hsa-mir-125b-1-3p (MIRT702756)
- hsa-mir-588 (MIRT702757)
- hsa-mir-4701-5p (MIRT702758)
- hsa-mir-6727-5p (MIRT702759)
- hsa-mir-6084 (MIRT702760)
- hsa-mir-6762-3p (MIRT702761)
- hsa-mir-4755-3p (MIRT702762)
- hsa-mir-6774-5p (MIRT702763)
- hsa-mir-635 (MIRT702764)
- hsa-mir-4508 (MIRT702765)
- hsa-mir-6775-5p (MIRT702766)
- hsa-mir-5090 (MIRT702767)
- hsa-mir-10b-3p (MIRT702768)
- hsa-mir-6867-5p (MIRT708106)
- hsa-mir-5003-5p (MIRT708107)
- hsa-mir-15b-3p (MIRT731817)
- hsa-mir-7-1-3p (MIRT732245)
- hsa-mir-125b-5p (MIRT733120)
- hsa-mir-141-3p (MIRT733327)
- hsa-mir-214-5p (MIRT735073)
- hsa-mir-448 (MIRT735474)
- hsa-mir-217 (MIRT735547)
miRNA Products
- Search ViGene Biosciences for IGF1R
Inhibitory RNA Products
- Origene RNAi and shrna products in human, mouse, rat for IGF1R
- Browse OriGene Inhibitory RNA Products For IGF1R
- genomics-online: shRNA clones - Search results for 140 available IGF1R gene related products
- Overview of 140 available IGF1R gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for IGF1R gene
Clone Products
- Sino Biological Human cDNA Clone for IGF1R
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for IGF1R
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for IGF1R
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for IGF1R
- Applied Biological Materials Clones for IGF1R
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for IGF1R
-
ViGene Biosciences adenoviral particle packaged cDNA for IGF1R gene
-
ViGene Biosciences lentiviral particle packaged cDNA for IGF1R gene
-
ViGene Biosciences ready-to-package AAV shRNAs for IGF1R gene
No data available for Transcription Factor Targets and HOMER Transcription for IGF1R Gene
Localization for IGF1R Gene
Subcellular locations from UniProtKB/Swiss-Prot for IGF1R Gene
- Cell membrane; Single-pass type I membrane protein.
| Compartment | Confidence |
|---|---|
| plasma membrane | 5 |
| extracellular | 3 |
| cytoskeleton | 2 |
| mitochondrion | 2 |
| nucleus | 2 |
| cytosol | 2 |
| peroxisome | 1 |
| endoplasmic reticulum | 1 |
| lysosome | 1 |
| endosome | 1 |
- Vesicles (1)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005886 | plasma membrane | ISS,TAS | -- |
| GO:0005887 | integral component of plasma membrane | IC | 7679099 |
| GO:0016020 | membrane | IEA,IDA | 8452530 |
| GO:0016021 | integral component of membrane | IEA | -- |
| GO:0035867 | alphav-beta3 integrin-IGF-1-IGF1R complex | IDA | 19578119 |
Pathways & Interactions for IGF1R Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Apoptotic Pathways in Synovial Fibroblasts |
.74
.66
|
.65
.61
.60
.57
|
| 2 | GPCR Pathway |
.73
.62
|
.55
|
| 3 | Endometrial cancer |
.52
.47
|
.32
|
| 4 | ERK Signaling |
.61
.58
|
.49
|
| 5 | Nanog in Mammalian ESC Pluripotency |
.61
|
.48
|
Pathways by source for IGF1R Gene
2 Sino Biological pathways for IGF1R Gene
2 Cell Signaling Technology pathways for IGF1R Gene
13 BioSystems pathways for IGF1R Gene
5 Reactome pathways for IGF1R Gene
29 KEGG pathways for IGF1R Gene
13 GeneGo (Thomson Reuters) pathways for IGF1R Gene
3 R&D Systems pathways for IGF1R Gene
5 Tocris pathways for IGF1R Gene
Interacting Proteins for IGF1R Gene
Selected Interacting proteins:
ENSP00000268035
P08069-IGF1R_HUMAN
for IGF1R Gene via
STRING
MINT
IID
UniProtKB
SIGNOR curated interactions for IGF1R Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006468 | protein phosphorylation | IEA | -- |
| GO:0006955 | immune response | IMP | 16886151 |
| GO:0007165 | signal transduction | TAS | 3003744 |
| GO:0007169 | transmembrane receptor protein tyrosine kinase signaling pathway | IEA | -- |
| GO:0008284 | positive regulation of cell proliferation | TAS | 10749889 |
Drugs & Compounds for IGF1R Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Mecasermin | Approved, Investigational | Pharma | Target, agonist, inhibitor | 0 | ||
| Paclitaxel | Approved, Vet_approved | Pharma | Tubulin and Bcl2 inhibitor, Taxanes | 3027 | ||
| Insulin Glargine | Approved | Pharma | Target, agonist | 557 | ||
| Insulin Human | Approved, Investigational | Pharma | Target | 0 | ||
| Insulin Lispro | Approved | Pharma | Target | 264 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| IGF1 |
|
|
|
|||
| IGF2 |
|
|
|
|||
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
||
| Insulin (human) recombinant |
|
11061-68-0 |
|
|
||
| Picropodophyllotoxin |
|
477-47-4 |
|
|
(5) Tocris Compounds for IGF1R Gene
| Compound | Action | Cas Number |
|---|---|---|
| Demethylasterriquinone B1 | Selective insulin RTK activator | 78860-34-1 |
| GSK 1838705 | Potent IR and IGF1R inhibitor; also inhibits anaplastic lymphoma kinase (ALK) | 1116235-97-2 |
| Insulin (human) recombinant | Endogenous peptide agonist | 11061-68-0 |
| Picropodophyllotoxin | Selective IGF1R inhibitor | 477-47-4 |
| PQ 401 | IGF1R inhibitor | 196868-63-0 |
(14) ApexBio Compounds for IGF1R Gene
| Compound | Action | Cas Number |
|---|---|---|
| AG-1024 | Selective IGF-1R inhibitor | 65678-07-1 |
| AXL1717 | IGF-1R inhibitor,orally active | 477-47-4 |
| AZD-3463 | ALK/IGF1R inhibitor | 1356962-20-3 |
| BMS-536924 | IR/IGF-1R inhibitor | 468740-43-4 |
| BMS-754807 | IGF-1R/InsR inhibitor,potent and selective | 1001350-96-4 |
| GSK1838705A | IGF-IR/IR/ALK inhibitor, ATP-competitive | 1116235-97-2 |
| GSK1904529A | Selective IGF-1R/IR inhibitor | 1089283-49-7 |
| Linsitinib | IGF1R/IR inhibitor,potent and novel | 867160-71-2 |
| MK 0893 | Glucagon receptor/IGF-1R antagonist | 870823-12-4 |
| NVP-ADW742 | Selective IGF-1R inhibitor | 475488-23-4 |
| NVP-AEW541 | IGF-IR inhibitor, novel, potent and selective | 475489-16-8 |
| PQ 401 | IGF1R inhibitor,potent and cell-permeable | 196868-63-0 |
| TAE226 (NVP-TAE226) | FAK inhibitor,potent and ATP-competitive | 761437-28-9 |
| XL228 | IGF1R/AURORA /FGFR1-3/ABL/SRC family kinases inhibitor | 898280-07-4 |
Transcripts for IGF1R Gene
mRNA/cDNA for IGF1R Gene
- (9) REFSEQ mRNAs :
- (15) Additional mRNA sequences :
- (113) Selected AceView cDNA sequences:
- (17) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for IGF1R Gene
CRISPR Products
-
OriGene CRISPR knockouts for IGF1R
- genomics-online: gRNA clones - Search results for 140 available IGF1R gene related products
- Overview of 140 available IGF1R gene related products
- Applied Biological Materials CRISPR for IGF1R
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for IGF1R
- GenScript: Design CRISPR guide RNA sequences for IGF1R
miRNA Products
- Search ViGene Biosciences for IGF1R
Inhibitory RNA Products
- Origene RNAi and shrna products in human, mouse, rat for IGF1R
- Browse OriGene Inhibitory RNA Products For IGF1R
- genomics-online: shRNA clones - Search results for 140 available IGF1R gene related products
- Overview of 140 available IGF1R gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for IGF1R gene
Clone Products
- Sino Biological Human cDNA Clone for IGF1R
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for IGF1R
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for IGF1R
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for IGF1R
- Applied Biological Materials Clones for IGF1R
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
| ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | · | 10c | · | 10d | ^ | 11a | · | 11b | · | 11c | ^ | 12 | ^ | 13 | ^ | 14 | ^ | 15a | · | 15b | ^ | 16 | ^ | 17a | · | 17b | ^ | 18 | ^ | 19a | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP2: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP9: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP10: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP11: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP12: |
| ExUns: | 19b | ^ | 20 | ^ | 21 | ^ | 22 | ^ | 23 | ^ | 24 | ^ | 25 | ^ | 26a | · | 26b | ^ | 27 | ^ | 28 | ^ | 29 | ^ | 30a | · | 30b |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||||||||||||||||||||||
| SP2: | |||||||||||||||||||||||||||
| SP3: | |||||||||||||||||||||||||||
| SP4: | |||||||||||||||||||||||||||
| SP5: | |||||||||||||||||||||||||||
| SP6: | |||||||||||||||||||||||||||
| SP7: | |||||||||||||||||||||||||||
| SP8: | |||||||||||||||||||||||||||
| SP9: | |||||||||||||||||||||||||||
| SP10: | |||||||||||||||||||||||||||
| SP11: | |||||||||||||||||||||||||||
| SP12: |
Expression for IGF1R Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Bone (Muscoskeletal System)
- Bone marrow-derived mesenchymal stem cells
- Bone marrow-derived mesenchymal stem cells (family)
- Endochondral Preosteoblasts Rostral Endochondral Facial Bones
- Endochondral Osteoblasts Endochondral Facial Bones
- Endochondral Preosteoblasts Caudal Facial Endochondral Bones
-
Hair (Integumentary System)
- Fetal Precortex Cells Hair Shaft
- Guard Dermal Papilla Cells Dermal Papilla
- Zigzag Dermal Papilla Cells Dermal Papilla
- Fetal Matrix Cells Hair Follicle
-
Epithelial Cells
- Fetal Precortex Cells Hair Shaft
- Mature Choroid Plexus Cells Choroid Plexus
- Fetal Matrix Cells Hair Follicle
- Mesenchymal Stem Cells
-
Brain (Nervous System)
- Choroid Plexus Progenitor Cells Choroid Plexus
- Mature Choroid Plexus Cells Choroid Plexus
-
Dermis (Integumentary System)
- Guard Dermal Papilla Cells Dermal Papilla
- Zigzag Dermal Papilla Cells Dermal Papilla
-
Testis (Reproductive System)
- Testis Somatic Cells Primitive Gonad
-
Gonad (Reproductive System)
- Testis Somatic Cells Primitive Gonad
-
Prostate (Endocrine System)
This gene is overexpressed in Fetal Brain (13.5), Bone (11.7), Retina (6.6), Lung (6.4), and Testis (6.3).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for IGF1R Gene
NURSA nuclear receptor signaling pathways regulating expression of IGF1R Gene:
IGF1RSOURCE GeneReport for Unigene cluster for IGF1R Gene:
Hs.643120mRNA Expression by UniProt/SwissProt for IGF1R Gene:
P08069-IGF1R_HUMAN
Tissue specificity:
Found as a hybrid receptor with INSR in muscle, heart, kidney, adipose tissue, skeletal muscle, hepatoma, fibroblasts, spleen and placenta (at protein level). Expressed in a variety of tissues. Overexpressed in tumors, including melanomas, cancers of the colon, pancreas prostate and kidney.
Evidence on tissue expression from TISSUES for IGF1R Gene
- Nervous system(4.8)
- Skin(4.5)
- Pancreas(3.3)
- Lung(3)
- Muscle(2.8)
- Intestine(2.7)
- Kidney(2.6)
- Liver(2.6)
- Heart(2.5)
- Blood(2.4)
- Thyroid gland(2.3)
- Eye(2.1)
Phenotype-based relationships between genes and organs from Gene ORGANizer for IGF1R Gene
Germ Layers:
- ectoderm
- mesoderm
Systems:
- integumentary
- nervous
- skeletal muscle
- skeleton
Regions:
Head and neck:
- brain
- face
- head
- jaw
- lip
- mandible
- maxilla
- mouth
- neck
- nose
- skull
Thorax:
- breast
- chest wall
- clavicle
- rib
- rib cage
- scapula
- sternum
Pelvis:
- pelvis
Limb:
- ankle
- arm
- digit
- elbow
- femur
- fibula
- finger
- foot
- forearm
- hand
- hip
- humerus
- knee
- lower limb
- radius
- shin
- shoulder
- thigh
- tibia
- toe
- ulna
- upper limb
- wrist
General:
- skin
- spinal column
- vertebrae
Primer Products
-
OriGene qPCR primer pairs for IGF1R
No data available for mRNA differential expression in normal tissues for IGF1R Gene
Orthologs for IGF1R Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | IGF1R 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | IGFR1 34 |
|
OneToOne | |
| IGF1R 33 |
|
||||
| dog (Canis familiaris) |
Mammalia | IGF1R 33 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Igf1r 33 16 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Igf1r 33 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | IGF1R 34 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | IGF1R 34 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | IGF1R 33 34 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | IGF1R 34 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | igf1r 33 |
|
||
| Str.14302 33 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | LOC398022 33 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | igf1ra 33 34 |
|
||
| igf1rb 34 |
|
OneToMany | |||
| fruit fly (Drosophila melanogaster) |
Insecta | InR 35 33 |
|
||
| sev 35 |
|
|
|||
| hop 35 |
|
|
|||
| CG3837 35 34 |
|
||||
| CG10702 35 |
|
|
|||
| African malaria mosquito (Anopheles gambiae) |
Insecta | INR 33 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | daf-2 35 33 34 |
|
||
| R151.4 35 |
|
|
|||
| K09B11.5 35 |
|
|
|||
| C24G6.2a 35 |
|
|
|||
| C24G6.2b 35 |
|
|
|||
| W02A2.4 35 |
|
|
|||
| T25B9.5 35 |
|
|
|||
| Y69E1A.3 35 |
|
|
|||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToMany | |
| sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.344 33 |
|
- Species where no ortholog for IGF1R was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for IGF1R Gene
Paralogs for IGF1R Gene
(27) SIMAP similar genes for IGF1R Gene using alignment to 7 proteins:
Variants for IGF1R Gene
| SNP ID | Clin | Chr 15 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1007391014 | uncertain-significance, Insulin-Like Growth Factor I Resistance | 98,960,905(+) | G/A/C | 3_prime_UTR_variant, genic_downstream_transcript_variant | |
| rs1024322995 | uncertain-significance, Insulin-Like Growth Factor I Resistance | 98,958,484(+) | C/T | 3_prime_UTR_variant | |
| rs1025286045 | uncertain-significance, Insulin-Like Growth Factor I Resistance | 98,957,804(+) | T/C | 3_prime_UTR_variant, intron_variant | |
| rs1034126647 | uncertain-significance, Insulin-Like Growth Factor I Resistance | 98,963,674(+) | G/A | 3_prime_UTR_variant, genic_downstream_transcript_variant | |
| rs1058696 | likely-benign, Insulin-Like Growth Factor I Resistance | 98,959,298(+) | C/T | 3_prime_UTR_variant, genic_downstream_transcript_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| nsv952034 | CNV | deletion | 24416366 |
| nsv827457 | CNV | gain | 20364138 |
| nsv570705 | CNV | gain | 21841781 |
| nsv570701 | CNV | gain | 21841781 |
| nsv570694 | CNV | gain+loss | 21841781 |
| nsv526399 | CNV | loss | 19592680 |
| nsv1144746 | CNV | deletion | 24896259 |
| nsv1071238 | CNV | deletion | 25765185 |
| nsv1055008 | CNV | gain | 25217958 |
| nsv1045124 | CNV | gain | 25217958 |
| nsv1037264 | CNV | loss | 25217958 |
| esv3892740 | CNV | loss | 25118596 |