Free for academic non-profit institutions. Other users need a Commercial license

Aliases for HIPK4 Gene

Aliases for HIPK4 Gene

  • Homeodomain Interacting Protein Kinase 4 2 3 5
  • EC 2.7.11.1 4 56

External Ids for HIPK4 Gene

Previous GeneCards Identifiers for HIPK4 Gene

  • GC19M045577
  • GC19M040885
  • GC19M037320

Summaries for HIPK4 Gene

Entrez Gene Summary for HIPK4 Gene

  • This gene encodes a member of the homeodomain interacting protein kinase (HIPK) family of proteins. While other members of this family are found throughout vertebrates, this member is present only in mammals. Compared to other members of this family, the encoded protein lacks a nuclear localization signal and a C-terminal autoinhibitory domain. The encoded protein exhibits kinase activity and may phosphorylate the tumor suppressor protein p53. [provided by RefSeq, Jul 2016]

GeneCards Summary for HIPK4 Gene

HIPK4 (Homeodomain Interacting Protein Kinase 4) is a Protein Coding gene. Among its related pathways are Cellular senescence (KEGG). Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK1.

UniProtKB/Swiss-Prot for HIPK4 Gene

  • Protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter (By similarity). May act as a corepressor of transcription factors (Potential).

Additional gene information for HIPK4 Gene

No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HIPK4 Gene

Genomics for HIPK4 Gene

GeneHancer (GH) Regulatory Elements for HIPK4 Gene

Promoters and enhancers for HIPK4 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH19I040390 Promoter 0.7 EPDnew 550.8 +0.0 20 0.1 SP1 ZNF662 HIPK4 MIR6796
GH19I040441 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 11.4 -54.0 -54028 5.4 MLX ZFP64 FEZF1 DMAP1 IRF4 YY1 ZNF213 E2F8 ZNF143 SP3 SERTAD3 ENSG00000268366 LOC105372489 CCDC97 HNRNPUL1 SNRPA ZNF780B ENSG00000269843 FBL CYP2F2P
GH19I040190 Promoter/Enhancer 2.3 EPDnew FANTOM5 Ensembl ENCODE 10.4 +199.0 198983 2.3 HDGF PKNOX1 ARID4B SIN3A DMAP1 ZNF2 ZBTB7B ZNF766 ZNF213 ZNF207 MAP3K10 ZNF780B NUMBL CYP2G1P EID2B SUPT5H AKT2 PAF1 TTC9B CNTD2
GH19I040365 Promoter/Enhancer 1.9 EPDnew Ensembl ENCODE 8.2 +23.2 23245 3.3 HDGF PKNOX1 ATF1 SIN3A POLR2B GLIS2 RUNX3 SP3 REST GLIS1 PLD3 ENSG00000206925 SERTAD1 SERTAD3 TTC9B HIPK4 PRX MIR6796 ENSG00000279759
GH19I040622 Enhancer 1.4 Ensembl ENCODE dbSUPER 9.6 -233.3 -233308 2 HDGF PKNOX1 ATF1 FOXA2 SIN3A ZNF2 GLIS2 CBX5 KLF7 ATF7 ZNF780B SHKBP1 NUMBL CYP2G1P ZNF780A ZNF546 SERTAD3 SERTAD1 HIPK4 TTC9B
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around HIPK4 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the HIPK4 gene promoter:

Genomic Locations for HIPK4 Gene

Genomic Locations for HIPK4 Gene
chr19:40,379,271-40,390,221
(GRCh38/hg38)
Size:
10,951 bases
Orientation:
Minus strand
chr19:40,885,178-40,896,094
(GRCh37/hg19)

Genomic View for HIPK4 Gene

Genes around HIPK4 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HIPK4 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HIPK4 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for HIPK4 Gene

Proteins for HIPK4 Gene

  • Protein details for HIPK4 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8NE63-HIPK4_HUMAN
    Recommended name:
    Homeodomain-interacting protein kinase 4
    Protein Accession:
    Q8NE63
    Secondary Accessions:
    • A8K863
    • Q96M54

    Protein attributes for HIPK4 Gene

    Size:
    616 amino acids
    Molecular mass:
    69425 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=BAB71458.1; Type=Miscellaneous discrepancy; Note=Aberrant splicing.; Evidence={ECO:0000305};

neXtProt entry for HIPK4 Gene

Selected DME Specific Peptides for HIPK4 Gene

Q8NE63:
  • RVKVIDFGSAS
  • ALARLKELAIIHADLKPENIMLVDQTRCPFRVKVIDFGSA

Post-translational modifications for HIPK4 Gene

Other Protein References for HIPK4 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for HIPK4 Gene

Gene Families for HIPK4 Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Graphical View of Domain Structure for InterPro Entry

Q8NE63

UniProtKB/Swiss-Prot:

HIPK4_HUMAN :
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
Family:
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
genes like me logo Genes that share domains with HIPK4: view

Function for HIPK4 Gene

Molecular function for HIPK4 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter (By similarity). May act as a corepressor of transcription factors (Potential).

Enzyme Numbers (IUBMB) for HIPK4 Gene

Gene Ontology (GO) - Molecular Function for HIPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003677 DNA binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0005515 protein binding IPI 25416956
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with HIPK4: view
genes like me logo Genes that share phenotypes with HIPK4: view

Clone Products

  • Addgene plasmids for HIPK4

No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for HIPK4 Gene

Localization for HIPK4 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HIPK4 Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HIPK4 gene
Compartment Confidence
nucleus 3
cytosol 1

Gene Ontology (GO) - Cellular Components for HIPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IEA --
genes like me logo Genes that share ontologies with HIPK4: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for HIPK4 Gene

Pathways & Interactions for HIPK4 Gene

SuperPathways for HIPK4 Gene

SuperPathway Contained pathways
1 Cellular senescence (KEGG)
genes like me logo Genes that share pathways with HIPK4: view

Pathways by source for HIPK4 Gene

1 KEGG pathway for HIPK4 Gene

Gene Ontology (GO) - Biological Process for HIPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0016310 phosphorylation IEA --
GO:0016572 histone phosphorylation IEA --
GO:0018105 peptidyl-serine phosphorylation IEA --
GO:0046777 protein autophosphorylation IEA --
genes like me logo Genes that share ontologies with HIPK4: view

No data available for SIGNOR curated interactions for HIPK4 Gene

Drugs & Compounds for HIPK4 Gene

No Compound Related Data Available

Transcripts for HIPK4 Gene

mRNA/cDNA for HIPK4 Gene

(2) REFSEQ mRNAs :
(5) Additional mRNA sequences :
(18) Selected AceView cDNA sequences:
(1) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for HIPK4 Gene

Homeodomain interacting protein kinase 4:
Representative Sequences:

Clone Products

  • Addgene plasmids for HIPK4

Alternative Splicing Database (ASD) splice patterns (SP) for HIPK4 Gene

No ASD Table

Relevant External Links for HIPK4 Gene

GeneLoc Exon Structure for
HIPK4
ECgene alternative splicing isoforms for
HIPK4

Expression for HIPK4 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for HIPK4 Gene

mRNA differential expression in normal tissues according to GTEx for HIPK4 Gene

This gene is overexpressed in Testis (x15.9), Brain - Nucleus accumbens (basal ganglia) (x5.4), and Brain - Cortex (x4.0).

NURSA nuclear receptor signaling pathways regulating expression of HIPK4 Gene:

HIPK4

SOURCE GeneReport for Unigene cluster for HIPK4 Gene:

Hs.79363
genes like me logo Genes that share expression patterns with HIPK4: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein differential expression in normal tissues , Protein expression , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt , Evidence on tissue expression from TISSUES and Phenotype-based relationships between genes and organs from Gene ORGANizer for HIPK4 Gene

Orthologs for HIPK4 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for HIPK4 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia HIPK4 33 34
  • 98.32 (n)
dog
(Canis familiaris)
Mammalia HIPK4 33
  • 88.65 (n)
-- 34
  • 83 (a)
ManyToMany
cow
(Bos Taurus)
Mammalia HIPK4 33 34
  • 87.86 (n)
mouse
(Mus musculus)
Mammalia Hipk4 33 16 34
  • 83.58 (n)
rat
(Rattus norvegicus)
Mammalia Hipk4 33
  • 83.25 (n)
oppossum
(Monodelphis domestica)
Mammalia HIPK4 34
  • 79 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia HIPK4 34
  • 63 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia HIPK4 34
  • 58 (a)
OneToOne
worm
(Caenorhabditis elegans)
Secernentea C36B7.2 34
  • 20 (a)
ManyToMany
C36B7.1 34
  • 19 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes YAK1 34
  • 15 (a)
OneToMany
Species where no ortholog for HIPK4 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)
  • zebrafish (Danio rerio)

Evolution for HIPK4 Gene

ENSEMBL:
Gene Tree for HIPK4 (if available)
TreeFam:
Gene Tree for HIPK4 (if available)

Paralogs for HIPK4 Gene

(5) SIMAP similar genes for HIPK4 Gene using alignment to 1 proteins:

genes like me logo Genes that share paralogs with HIPK4: view

Variants for HIPK4 Gene

Sequence variations from dbSNP and Humsavar for HIPK4 Gene

SNP ID Clin Chr 19 pos Variation AA Info Type
rs193920880 uncertain-significance, Malignant tumor of prostate 40,380,712(-) C/T coding_sequence_variant, missense_variant
rs1000055875 -- 40,384,458(-) C/T intron_variant
rs1000109127 -- 40,380,895(-) G/A coding_sequence_variant, synonymous_variant
rs1000172461 -- 40,387,591(-) G/A intron_variant
rs1000386301 -- 40,390,086(-) G/A 5_prime_UTR_variant

Structural Variations from Database of Genomic Variants (DGV) for HIPK4 Gene

Variant ID Type Subtype PubMed ID
nsv833831 CNV loss 17160897
esv3644347 CNV loss 21293372

Variation tolerance for HIPK4 Gene

Residual Variation Intolerance Score: 62.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.82; 67.03% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for HIPK4 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
HIPK4

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HIPK4 Gene

Disorders for HIPK4 Gene

Additional Disease Information for HIPK4

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for HIPK4 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for HIPK4 Gene

Publications for HIPK4 Gene

  1. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4 58
  2. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
  3. Effect of tyrosine autophosphorylation on catalytic activity and subcellular localisation of homeodomain-interacting protein kinases (HIPK). (PMID: 25630557) van der Laden J … Becker W (Cell communication and signaling : CCS 2015) 3 58
  4. Integration of stress signals by homeodomain interacting protein kinases. (PMID: 24225127) Schmitz ML … Hornung J (Biological chemistry 2014) 3 58
  5. A proteome-scale map of the human interactome network. (PMID: 25416956) Rolland T … Vidal M (Cell 2014) 3 58

Products for HIPK4 Gene

Sources for HIPK4 Gene

Content
Loading form....