Aliases for HIPK3 Gene

Aliases for HIPK3 Gene

  • Homeodomain Interacting Protein Kinase 3 2 3 5
  • Homeodomain-Interacting Protein Kinase 3 2 3 4
  • Androgen Receptor-Interacting Nuclear Protein Kinase 3 4
  • Fas-Interacting Serine/Threonine-Protein Kinase 3 4
  • Homolog Of Protein Kinase YAK1 3 4
  • EC 2.7.11.1 4 52

External Ids for HIPK3 Gene

Previous GeneCards Identifiers for HIPK3 Gene

  • GC11P034811
  • GC11P033957
  • GC11P033318
  • GC11P033272
  • GC11P033264
  • GC11P033235
  • GC11P032973

Summaries for HIPK3 Gene

GeneCards Summary for HIPK3 Gene

HIPK3 (Homeodomain Interacting Protein Kinase 3) is a Protein Coding gene. Diseases associated with HIPK3 include Amyotrophic Lateral Sclerosis 1. Among its related pathways are Cellular senescence (KEGG). Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK2.

UniProtKB/Swiss-Prot Summary for HIPK3 Gene

  • Serine/threonine-protein kinase involved in transcription regulation, apoptosis and steroidogenic gene expression. Phosphorylates JUN and RUNX2. Seems to negatively regulate apoptosis by promoting FADD phosphorylation. Enhances androgen receptor-mediated transcription. May act as a transcriptional corepressor for NK homeodomain transcription factors. The phosphorylation of NR5A1 activates SF1 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. In osteoblasts, supports transcription activation: phosphorylates RUNX2 that synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE).

Gene Wiki entry for HIPK3 Gene

Additional gene information for HIPK3 Gene

No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for HIPK3 Gene

Genomics for HIPK3 Gene

GeneHancer (GH) Regulatory Elements for HIPK3 Gene

Promoters and enhancers for HIPK3 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around HIPK3 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for HIPK3

Top Transcription factor binding sites by QIAGEN in the HIPK3 gene promoter:
  • AhR
  • CREB
  • deltaCREB
  • Evi-1
  • FOXI1
  • HFH-3
  • Nkx2-5
  • Pax-4a
  • Sox5
  • STAT3

Genomic Locations for HIPK3 Gene

Genomic Locations for HIPK3 Gene
chr11:33,256,672-33,357,023
(GRCh38/hg38)
Size:
100,352 bases
Orientation:
Plus strand
chr11:33,278,218-33,378,569
(GRCh37/hg19)
Size:
100,352 bases
Orientation:
Plus strand

Genomic View for HIPK3 Gene

Genes around HIPK3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HIPK3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HIPK3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for HIPK3 Gene

Proteins for HIPK3 Gene

  • Protein details for HIPK3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H422-HIPK3_HUMAN
    Recommended name:
    Homeodomain-interacting protein kinase 3
    Protein Accession:
    Q9H422
    Secondary Accessions:
    • O14632
    • Q2PBG4
    • Q2PBG5
    • Q92632
    • Q9HAS2

    Protein attributes for HIPK3 Gene

    Size:
    1215 amino acids
    Molecular mass:
    133743 Da
    Quaternary structure:
    • Interacts with Nkx1-2. Interacts with FAS and DAXX. Probably part of a complex consisting of HIPK3, FAS and FADD. Interacts with and stabilizes ligand-bound androgen receptor (AR) (By similarity). Interacts with UBL1/SUMO-1. Binds to NR5A1/SF1, SPEN/MINT and RUNX2.

    Alternative splice isoforms for HIPK3 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for HIPK3 Gene

Selected DME Specific Peptides for HIPK3 Gene

Q9H422:
  • HLLDFPHS
  • CGLKRKSEE
  • KSKEARKYIFN
  • SDTDEEE
  • ETLNHPF
  • EGDYQLVQHE
  • RVKVIDFGSAS
  • IRPILQQVATAL
  • EIVAIKILKNHPSYARQGQIEVSIL
  • NHTCLVFEMLEQNLYDFLKQNKFSPLPLK
  • VCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAE
  • EYDQIRYISQTQGLP

Post-translational modifications for HIPK3 Gene

Domains & Families for HIPK3 Gene

Gene Families for HIPK3 Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for HIPK3 Gene

Suggested Antigen Peptide Sequences for HIPK3 Gene

GenScript: Design optimal peptide antigens:
  • Homolog of protein kinase YAK1 (HIPK3_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9H422

UniProtKB/Swiss-Prot:

HIPK3_HUMAN :
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
Family:
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
genes like me logo Genes that share domains with HIPK3: view

Function for HIPK3 Gene

Molecular function for HIPK3 Gene

UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase involved in transcription regulation, apoptosis and steroidogenic gene expression. Phosphorylates JUN and RUNX2. Seems to negatively regulate apoptosis by promoting FADD phosphorylation. Enhances androgen receptor-mediated transcription. May act as a transcriptional corepressor for NK homeodomain transcription factors. The phosphorylation of NR5A1 activates SF1 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. In osteoblasts, supports transcription activation: phosphorylates RUNX2 that synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1;.
GENATLAS Biochemistry:
homeodomain interacting protein kinase 3,highly expressed in heart and muscle tissue,localizing in nuclear speckles,corepressor for homeo domain transcription factors,maybe involved in cell cycle regulation,over-expressed in multidrugg resistant cell-lines

Enzyme Numbers (IUBMB) for HIPK3 Gene

Phenotypes From GWAS Catalog for HIPK3 Gene

Gene Ontology (GO) - Molecular Function for HIPK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity TAS,IDA 14766760
GO:0004674 protein serine/threonine kinase activity ISS,IDA 11034606
GO:0004713 protein tyrosine kinase activity IBA 21873635
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
genes like me logo Genes that share ontologies with HIPK3: view
genes like me logo Genes that share phenotypes with HIPK3: view

Animal Models for HIPK3 Gene

MGI Knock Outs for HIPK3:
  • Hipk3 Hipk3<tm1b(EUCOMM)Hmgu>

Animal Model Products

  • Taconic Biosciences Mouse Models for HIPK3

CRISPR Products

miRNA for HIPK3 Gene

miRTarBase miRNAs that target HIPK3

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for HIPK3

Clone Products

  • Addgene plasmids for HIPK3

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HIPK3 Gene

Localization for HIPK3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HIPK3 Gene

Cytoplasm. Nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HIPK3 gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 2
mitochondrion 2
extracellular 1
cytoskeleton 1
peroxisome 1
endoplasmic reticulum 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Nuclear bodies (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for HIPK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IBA 21873635
GO:0005737 cytoplasm IBA 21873635
GO:0005829 cytosol IDA --
GO:0016604 nuclear body IDA --
GO:0016605 PML body IBA 21873635
genes like me logo Genes that share ontologies with HIPK3: view

Pathways & Interactions for HIPK3 Gene

PathCards logo

SuperPathways for HIPK3 Gene

SuperPathway Contained pathways
1 Cellular senescence (KEGG)
genes like me logo Genes that share pathways with HIPK3: view

Pathways by source for HIPK3 Gene

1 KEGG pathway for HIPK3 Gene

SIGNOR curated interactions for HIPK3 Gene

Activates:

Gene Ontology (GO) - Biological Process for HIPK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IDA 14766760
GO:0006915 apoptotic process IEA --
GO:0009299 mRNA transcription IDA 17210646
GO:0016310 phosphorylation IEA --
GO:0018105 peptidyl-serine phosphorylation ISS 11034606
genes like me logo Genes that share ontologies with HIPK3: view

Drugs & Compounds for HIPK3 Gene

(4) Drugs for HIPK3 Gene - From: DrugBank, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
fostamatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors 0
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0

(1) Additional Compounds for HIPK3 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor 58-64-0
genes like me logo Genes that share compounds with HIPK3: view

Transcripts for HIPK3 Gene

mRNA/cDNA for HIPK3 Gene

4 REFSEQ mRNAs :
16 NCBI additional mRNA sequence :
6 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for HIPK3

Clone Products

  • Addgene plasmids for HIPK3

Alternative Splicing Database (ASD) splice patterns (SP) for HIPK3 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16a · 16b
SP1:
SP2: -

Relevant External Links for HIPK3 Gene

GeneLoc Exon Structure for
HIPK3

Expression for HIPK3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for HIPK3 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for HIPK3 Gene



Protein tissue co-expression partners for HIPK3 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for HIPK3

SOURCE GeneReport for Unigene cluster for HIPK3 Gene:

Hs.201918

mRNA Expression by UniProt/SwissProt for HIPK3 Gene:

Q9H422-HIPK3_HUMAN
Tissue specificity: Overexpressed in multidrug resistant cells. Highly expressed in heart and skeletal muscle, and at lower levels in placenta, pancreas, brain, spleen, prostate, thymus, testis, small intestine, colon and leukocytes. Not found in liver and lung.

Evidence on tissue expression from TISSUES for HIPK3 Gene

  • Heart(2.5)
  • Muscle(2.3)
  • Intestine(2)
  • Kidney(2)
genes like me logo Genes that share expression patterns with HIPK3: view

No data available for mRNA differential expression in normal tissues , Protein differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HIPK3 Gene

Orthologs for HIPK3 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for HIPK3 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia HIPK3 31 30
  • 99.75 (n)
OneToOne
dog
(Canis familiaris)
Mammalia HIPK3 31 30
  • 94.21 (n)
OneToOne
cow
(Bos Taurus)
Mammalia HIPK3 31 30
  • 93.31 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Hipk3 17 31 30
  • 88.89 (n)
rat
(Rattus norvegicus)
Mammalia Hipk3 30
  • 88.83 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia HIPK3 31
  • 83 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia HIPK3 31
  • 82 (a)
OneToOne
chicken
(Gallus gallus)
Aves HIPK3 31 30
  • 80.56 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia HIPK3 31
  • 79 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia hipk3 30
  • 72.59 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.10538 30
zebrafish
(Danio rerio)
Actinopterygii hipk3b 31 30
  • 67.08 (n)
OneToMany
hipk3a 31
  • 60 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta hipk 31
  • 33 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea hpk-1 31
  • 40 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes YAK1 31
  • 25 (a)
OneToMany
Species where no ortholog for HIPK3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for HIPK3 Gene

ENSEMBL:
Gene Tree for HIPK3 (if available)
TreeFam:
Gene Tree for HIPK3 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for HIPK3: view image

Paralogs for HIPK3 Gene

(2) SIMAP similar genes for HIPK3 Gene using alignment to 2 proteins:

  • HIPK3_HUMAN
  • E9PKD7_HUMAN
genes like me logo Genes that share paralogs with HIPK3: view

Variants for HIPK3 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for HIPK3 Gene

SNP ID Clinical significance and condition Chr 11 pos Variation AA Info Type
785343 Benign: not provided 33,338,835(+) G/A MISSENSE_VARIANT
rs11032229 - p.Ser500Asn
rs266472 - p.Val474Ile
rs34193811 - p.Gln142Arg
rs34698015 - p.Gly170Glu

Additional dbSNP identifiers (rs#s) for HIPK3 Gene

Structural Variations from Database of Genomic Variants (DGV) for HIPK3 Gene

Variant ID Type Subtype PubMed ID
dgv1093n100 CNV gain 25217958
dgv11n68 CNV gain 17160897
dgv1742n54 CNV gain 21841781
esv2677639 CNV deletion 23128226
esv2761660 CNV gain 21179565
esv2762904 CNV gain 21179565
esv3625876 CNV loss 21293372
esv3625877 CNV gain 21293372
esv3625878 CNV loss 21293372
esv3625879 CNV gain 21293372
esv3625880 CNV gain 21293372
nsv1045088 CNV gain 25217958
nsv1051437 CNV gain 25217958
nsv1054720 CNV gain 25217958
nsv1122604 CNV deletion 24896259
nsv1127173 CNV deletion 24896259
nsv467786 CNV gain 19166990
nsv521130 CNV gain 19592680
nsv951599 CNV duplication 24416366

Variation tolerance for HIPK3 Gene

Residual Variation Intolerance Score: 11.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.90; 59.22% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for HIPK3 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
HIPK3

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HIPK3 Gene

Disorders for HIPK3 Gene

MalaCards: The human disease database

(1) MalaCards diseases for HIPK3 Gene - From: DISEASES

Disorder Aliases PubMed IDs
amyotrophic lateral sclerosis 1
  • als1
- elite association - COSMIC cancer census association via MalaCards
Search HIPK3 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for HIPK3

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with HIPK3: view

No data available for UniProtKB/Swiss-Prot and Genatlas for HIPK3 Gene

Publications for HIPK3 Gene

  1. Identification and sequence of human PKY, a putative kinase with increased expression in multidrug-resistant cells, with homology to yeast protein kinase Yak1. (PMID: 9373137) Begley DA … Abraham I (Gene 1997) 2 3 4 23 54
  2. Cyclic AMP stimulates SF-1-dependent CYP11A1 expression through homeodomain-interacting protein kinase 3-mediated Jun N-terminal kinase and c-Jun phosphorylation. (PMID: 17210646) Lan HC … Chung BC (Molecular and cellular biology 2007) 3 4 23 54
  3. JNK regulates HIPK3 expression and promotes resistance to Fas-mediated apoptosis in DU 145 prostate carcinoma cells. (PMID: 14766760) Curtin JF … Cotter TG (The Journal of biological chemistry 2004) 3 4 23 54
  4. An approach based on a genome-wide association study reveals candidate loci for narcolepsy. (PMID: 20677014) Shimada M … Tokunaga K (Human genetics 2010) 3 41 54
  5. MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia. (PMID: 20347265) Xu Y … Liu P (Schizophrenia research 2010) 3 41 54

Products for HIPK3 Gene

Sources for HIPK3 Gene