Free for academic non-profit institutions. Other users need a Commercial license

Aliases for HIPK1 Gene

Aliases for HIPK1 Gene

  • Homeodomain Interacting Protein Kinase 1 2 3 5
  • Nuclear Body-Associated Kinase 2 3 4
  • EC 2.7.11.1 4 56
  • Nbak2 3 4
  • Myak 3 4
  • Homeodomain Interacting Protein Kinase 1-Like Protein 3
  • Homeodomain-Interacting Protein Kinase 1 3
  • Nuclear Body Associated Kinase 2b 3
  • KIAA0630 4

External Ids for HIPK1 Gene

Previous GeneCards Identifiers for HIPK1 Gene

  • GC01P113572
  • GC01P113770
  • GC01P114184
  • GC01P114203
  • GC01P114273
  • GC01P114471
  • GC01P112330

Summaries for HIPK1 Gene

Entrez Gene Summary for HIPK1 Gene

  • The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq, Jul 2008]

GeneCards Summary for HIPK1 Gene

HIPK1 (Homeodomain Interacting Protein Kinase 1) is a Protein Coding gene. Among its related pathways are Cardiac conduction and Gene Expression. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK2.

UniProtKB/Swiss-Prot for HIPK1 Gene

  • Serine/threonine-protein kinase involved in transcription regulation and TNF-mediated cellular apoptosis. Plays a role as a corepressor for homeodomain transcription factors. Phosphorylates DAXX and MYB. Phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. Inactivates MYB transcription factor activity by phosphorylation. Prevents MAP3K5-JNK activation in the absence of TNF. TNF triggers its translocation to the cytoplasm in response to stress stimuli, thus activating nuclear MAP3K5-JNK by derepression and promoting apoptosis. May be involved in anti-oxidative stress responses. Involved in the regulation of eye size, lens formation and retinal lamination during late embryogenesis. Promotes angiogenesis and to be involved in erythroid differentiation. May be involved in malignant squamous cell tumor formation.

Gene Wiki entry for HIPK1 Gene

Additional gene information for HIPK1 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HIPK1 Gene

Genomics for HIPK1 Gene

GeneHancer (GH) Regulatory Elements for HIPK1 Gene

Promoters and enhancers for HIPK1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH01I113927 Promoter/Enhancer 2.6 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 553.2 +2.7 2716 8.4 MLX ZFP64 FEZF1 DMAP1 YY1 ZNF213 E2F8 ZNF143 SP3 NFYC HIPK1 TRIM33 LOC100421402 LRIG2 RSBN1 SIKE1 DCLRE1B OLFML3 AP4B1 AP4B1-AS1
GH01I113950 Promoter/Enhancer 1 EPDnew dbSUPER 550.3 +21.8 21835 0.1 ZNF316 ZNF629 CREB1 CEBPG ATF7 ATF2 HIPK1 OLFML3 HIPK1-AS1
GH01I113953 Promoter/Enhancer 0.7 EPDnew dbSUPER 550.3 +24.7 24695 0.1 HIPK1 AP4B1 DCLRE1B OLFML3 HIPK1-AS1
GH01I113869 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 11 -56.0 -56013 7.6 HDGF PKNOX1 ATF1 SMAD1 YBX1 IRF4 ZNF766 ZNF207 ZNF143 ATF7 PTPN22 AP4B1 PHTF1 RSBN1 DCLRE1B ENSG00000231128 HIPK1 HIPK1-AS1 OLFML3 AP4B1-AS1
GH01I113857 Enhancer 1 Ensembl ENCODE 16 -69.3 -69338 4.7 HDAC1 NFRKB BATF IRF4 ZNF207 ATF7 RCOR1 BCLAF1 IKZF2 RUNX3 HIPK1 AP4B1 DCLRE1B BCL2L15 HIPK1-AS1 PTPN22 OLFML3 PHTF1 GC01M113841 AP4B1-AS1
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around HIPK1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the HIPK1 gene promoter:

Genomic Locations for HIPK1 Gene

Genomic Locations for HIPK1 Gene
chr1:113,929,192-113,977,869
(GRCh38/hg38)
Size:
48,678 bases
Orientation:
Plus strand
chr1:114,471,814-114,520,491
(GRCh37/hg19)

Genomic View for HIPK1 Gene

Genes around HIPK1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HIPK1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HIPK1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for HIPK1 Gene

Proteins for HIPK1 Gene

  • Protein details for HIPK1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q86Z02-HIPK1_HUMAN
    Recommended name:
    Homeodomain-interacting protein kinase 1
    Protein Accession:
    Q86Z02
    Secondary Accessions:
    • A6NJ34
    • O75125
    • Q5SQL2
    • Q5SQL4
    • Q5SQL5
    • Q8IYD7
    • Q8NDN5
    • Q8NEB6
    • Q8TBZ1

    Protein attributes for HIPK1 Gene

    Size:
    1210 amino acids
    Molecular mass:
    130843 Da
    Quaternary structure:
    • Interacts with Nkx1-2, Nkx2-5, MYB, PARK7, DAXX and p53/TP53. Part of a cytoplasmic complex made of HIPK1, DAB2IP and MAP3K5 in response to TNF. This complex formation promotes MAP3K5-JNK activation and subsequent apoptosis.

    Alternative splice isoforms for HIPK1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for HIPK1 Gene

Selected DME Specific Peptides for HIPK1 Gene

Q86Z02:
  • HLLDFPHS
  • CGLKRKSEE
  • KSKEARKYIFN
  • SDTDEEE
  • LNYQSALY
  • EGDYQLVQHE
  • RVKVIDFGSAS
  • IRPILQQVATAL
  • EIVAIKILKNHPSYARQGQIEVSIL
  • NHTCLVFEMLEQNLYDFLKQNKFSPLPLK
  • SILSRLS
  • VCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAE
  • EYDQIRYISQTQGLP

Post-translational modifications for HIPK1 Gene

  • Autophosphorylated. Phosphorylated and activated by JNK1.
  • Degraded by PARK7 at the protein level.
  • Sumoylated. When conjugated it is directed to nuclear speckles. SENP1-mediated desumoylation is mediated by TNF in response to stress stimuli, triggering transient translocation from nucleus to cytoplasm.

Antibody Products

  • Abcam antibodies for HIPK1
  • Cloud-Clone Corp. Antibodies for HIPK1
  • Santa Cruz Biotechnology (SCBT) Antibodies for HIPK1

Domains & Families for HIPK1 Gene

Gene Families for HIPK1 Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins
  • Predicted membrane proteins
  • Predicted secreted proteins

Suggested Antigen Peptide Sequences for HIPK1 Gene

Graphical View of Domain Structure for InterPro Entry

Q86Z02

UniProtKB/Swiss-Prot:

HIPK1_HUMAN :
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
Family:
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
genes like me logo Genes that share domains with HIPK1: view

Function for HIPK1 Gene

Molecular function for HIPK1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase involved in transcription regulation and TNF-mediated cellular apoptosis. Plays a role as a corepressor for homeodomain transcription factors. Phosphorylates DAXX and MYB. Phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. Inactivates MYB transcription factor activity by phosphorylation. Prevents MAP3K5-JNK activation in the absence of TNF. TNF triggers its translocation to the cytoplasm in response to stress stimuli, thus activating nuclear MAP3K5-JNK by derepression and promoting apoptosis. May be involved in anti-oxidative stress responses. Involved in the regulation of eye size, lens formation and retinal lamination during late embryogenesis. Promotes angiogenesis and to be involved in erythroid differentiation. May be involved in malignant squamous cell tumor formation.

Enzyme Numbers (IUBMB) for HIPK1 Gene

Phenotypes From GWAS Catalog for HIPK1 Gene

Gene Ontology (GO) - Molecular Function for HIPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003677 DNA binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0005515 protein binding IPI 12702766
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with HIPK1: view
genes like me logo Genes that share phenotypes with HIPK1: view

Animal Models for HIPK1 Gene

MGI Knock Outs for HIPK1:

Animal Model Products

Clone Products

  • Addgene plasmids for HIPK1

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HIPK1 Gene

Localization for HIPK1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HIPK1 Gene

Nucleus. Cytoplasm. Note=Predominantly nuclear. Translocates from nucleus to cytoplasm in response to stress stimuli via SENP1-mediated desumoylation.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HIPK1 gene
Compartment Confidence
cytoskeleton 5
nucleus 5
cytosol 5
mitochondrion 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Centrosome (2)
  • Cytosol (2)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for HIPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,IDA 15701637
GO:0005654 nucleoplasm TAS,IDA --
GO:0005737 cytoplasm IDA,IEA 15701637
GO:0005813 centrosome IDA --
GO:0005829 cytosol IDA --
genes like me logo Genes that share ontologies with HIPK1: view

Pathways & Interactions for HIPK1 Gene

genes like me logo Genes that share pathways with HIPK1: view

Pathways by source for HIPK1 Gene

Gene Ontology (GO) - Biological Process for HIPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001654 eye development ISS 20579985
GO:0006351 transcription, DNA-templated IEA --
GO:0006355 regulation of transcription, DNA-templated IEA --
GO:0006468 protein phosphorylation IEA --
GO:0007224 smoothened signaling pathway IEA --
genes like me logo Genes that share ontologies with HIPK1: view

No data available for SIGNOR curated interactions for HIPK1 Gene

Drugs & Compounds for HIPK1 Gene

(7) Drugs for HIPK1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Palmitic Acid Approved, Experimental Pharma Full agonist, Agonist 23
Stearic acid Approved, Experimental Pharma 0
Myristic acid Experimental Pharma 0
Tridecanoic acid Experimental Pharma 0
arachidonic acid Experimental Nutra Activator 33

(5) Additional Compounds for HIPK1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
Arachidic acid
  • Arachate
  • Arachic acid
  • Arachidate
  • Arachidic acid
  • Eicosanoate
506-30-9
Heptadecanoic acid
  • Heptadecanoate
  • Heptadecanoic acid
  • Margarate
  • Margaric acid
  • Margarinate
506-12-7
Heptadecanoyl CoA
  • Heptadecanoate
  • Heptadecanoic acid
  • Heptadecanoic acid coa
  • Heptadecanoyl coenzyme A
  • Heptadecanoyl-coA
3546-17-6
Pentadecanoic acid
  • N-Pentadecanoate
  • N-Pentadecanoic acid
  • N-Pentadecylate
  • N-Pentadecylic acid
  • Pentadecanoate
1002-84-2
genes like me logo Genes that share compounds with HIPK1: view

Transcripts for HIPK1 Gene

Unigene Clusters for HIPK1 Gene

Homeodomain interacting protein kinase 1:
Representative Sequences:

Clone Products

  • Addgene plasmids for HIPK1

Alternative Splicing Database (ASD) splice patterns (SP) for HIPK1 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6a · 6b · 6c ^ 7 ^ 8 ^ 9 ^ 10a · 10b ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16a · 16b ^ 17a · 17b ^ 18 ^ 19 ^ 20 ^
SP1: - - - - - -
SP2: - -
SP3: - - - - - - -
SP4:
SP5:
SP6:
SP7:
SP8: - -

ExUns: 21a · 21b ^ 22a · 22b
SP1: -
SP2: -
SP3:
SP4: -
SP5: -
SP6:
SP7:
SP8:

Relevant External Links for HIPK1 Gene

GeneLoc Exon Structure for
HIPK1
ECgene alternative splicing isoforms for
HIPK1

Expression for HIPK1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for HIPK1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for HIPK1 Gene

This gene is overexpressed in Pancreas (66.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for HIPK1 Gene



Protein tissue co-expression partners for HIPK1 Gene

NURSA nuclear receptor signaling pathways regulating expression of HIPK1 Gene:

HIPK1

SOURCE GeneReport for Unigene cluster for HIPK1 Gene:

Hs.532363

mRNA Expression by UniProt/SwissProt for HIPK1 Gene:

Q86Z02-HIPK1_HUMAN
Tissue specificity: Ubiquitously expressed with highest levels in skeletal muscle and heart. Overexpressed in breast cancer cell lines. Isoform 2 is highly expressed in testis.

Evidence on tissue expression from TISSUES for HIPK1 Gene

  • Nervous system(4.7)
genes like me logo Genes that share expression patterns with HIPK1: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HIPK1 Gene

Orthologs for HIPK1 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for HIPK1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia HIPK1 33 34
  • 99.75 (n)
dog
(Canis familiaris)
Mammalia HIPK1 33 34
  • 94.82 (n)
cow
(Bos Taurus)
Mammalia HIPK1 34 33
  • 94.1 (n)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia HIPK1 34
  • 94 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Hipk1 33 16 34
  • 92.01 (n)
rat
(Rattus norvegicus)
Mammalia Hipk1 33
  • 91.49 (n)
oppossum
(Monodelphis domestica)
Mammalia HIPK1 34
  • 90 (a)
OneToOne
chicken
(Gallus gallus)
Aves HIPK1 33 34
  • 80.24 (n)
lizard
(Anolis carolinensis)
Reptilia HIPK1 34
  • 75 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia hipk1 33
  • 76.02 (n)
Str.1884 33
African clawed frog
(Xenopus laevis)
Amphibia Xl.21248 33
zebrafish
(Danio rerio)
Actinopterygii HIPK1 (1 of 2) 34
  • 57 (a)
OneToMany
HIPK1 (2 of 2) 34
  • 51 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta hipk 34
  • 33 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea hpk-1 34
  • 41 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes YAK1 34
  • 23 (a)
OneToMany
Species where no ortholog for HIPK1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for HIPK1 Gene

ENSEMBL:
Gene Tree for HIPK1 (if available)
TreeFam:
Gene Tree for HIPK1 (if available)

Paralogs for HIPK1 Gene

(12) SIMAP similar genes for HIPK1 Gene using alignment to 6 proteins:

genes like me logo Genes that share paralogs with HIPK1: view

Variants for HIPK1 Gene

Sequence variations from dbSNP and Humsavar for HIPK1 Gene

SNP ID Clin Chr 01 pos Variation AA Info Type
rs1000042630 -- 113,935,236(+) G/A genic_upstream_transcript_variant, intron_variant
rs1000068284 -- 113,935,092(+) C/T genic_upstream_transcript_variant, intron_variant
rs1000090081 -- 113,959,259(+) T/C genic_downstream_transcript_variant, intron_variant
rs1000109384 -- 113,936,685(+) G/A genic_upstream_transcript_variant, intron_variant
rs1000122783 -- 113,931,824(+) A/T genic_upstream_transcript_variant, intron_variant

Structural Variations from Database of Genomic Variants (DGV) for HIPK1 Gene

Variant ID Type Subtype PubMed ID
nsv523196 CNV loss 19592680
nsv951401 CNV duplication 24416366
esv3587253 CNV loss 21293372
esv3587252 CNV loss 21293372
esv3587251 CNV loss 21293372
esv3587240 CNV loss 21293372
esv3578118 CNV loss 25503493
esv3539767 CNV deletion 23714750
esv23869 CNV loss 19812545

Variation tolerance for HIPK1 Gene

Residual Variation Intolerance Score: 2.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 9.22; 88.03% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for HIPK1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
HIPK1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HIPK1 Gene

Disorders for HIPK1 Gene

Additional Disease Information for HIPK1

No disorders were found for HIPK1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for HIPK1 Gene

Publications for HIPK1 Gene

  1. Characterization of cells and gene-targeted mice deficient for the p53-binding kinase homeodomain-interacting protein kinase 1 (HIPK1). (PMID: 12702766) Kondo S … Thukral SK (Proceedings of the National Academy of Sciences of the United States of America 2003) 3 4 22 58
  2. HIPK1 interacts with c-Myb and modulates its activity through phosphorylation. (PMID: 19646965) Matre V … Gabrielsen OS (Biochemical and biophysical research communications 2009) 3 4 58
  3. DJ-1 interacts with HIPK1 and affects H2O2-induced cell death. (PMID: 16390825) Sekito A … Ariga H (Free radical research 2006) 3 4 58
  4. Tumor necrosis factor alpha-induced desumoylation and cytoplasmic translocation of homeodomain-interacting protein kinase 1 are critical for apoptosis signal-regulating kinase 1-JNK/p38 activation. (PMID: 15701637) Li X … Min W (The Journal of biological chemistry 2005) 3 4 58
  5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58

Products for HIPK1 Gene

  • Addgene plasmids for HIPK1

Sources for HIPK1 Gene

Content
Loading form....