Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when teth... See more...

Aliases for HDAC3 Gene

Aliases for HDAC3 Gene

  • Histone Deacetylase 3 2 3 4 5
  • EC 3.5.1.98 4 52
  • RPD3-2 3 4
  • SMAP45 3 4
  • HD3 3 4
  • KDAC3 3
  • RPD3 3

External Ids for HDAC3 Gene

Previous GeneCards Identifiers for HDAC3 Gene

  • GC05U990082
  • GC05M140983
  • GC05M141028
  • GC05M140980
  • GC05M136145

Summaries for HDAC3 Gene

Entrez Gene Summary for HDAC3 Gene

  • Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene. [provided by RefSeq, Jul 2008]

GeneCards Summary for HDAC3 Gene

HDAC3 (Histone Deacetylase 3) is a Protein Coding gene. Diseases associated with HDAC3 include Maxillary Cancer and Friedreich Ataxia. Among its related pathways are p75 NTR receptor-mediated signalling and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). Gene Ontology (GO) annotations related to this gene include chromatin binding and hydrolase activity. An important paralog of this gene is HDAC1.

UniProtKB/Swiss-Prot Summary for HDAC3 Gene

  • Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Participates in the BCL6 transcriptional repressor activity by deacetylating the H3 'Lys-27' (H3K27) on enhancer elements, antagonizing EP300 acetyltransferase activity and repressing proximal gene expression. Probably participates in the regulation of transcription through its binding to the zinc-finger transcription factor YY1; increases YY1 repression activity. Required to repress transcription of the POU1F1 transcription factor. Acts as a molecular chaperone for shuttling phosphorylated NR2C1 to PML bodies for sumoylation (PubMed:21444723, PubMed:23911289). Contributes, together with XBP1 isoform 1, to the activation of NFE2L2-mediated HMOX1 transcription factor gene expression in a PI(3)K/mTORC2/Akt-dependent signaling pathway leading to endothelial cell (EC) survival under disturbed flow/oxidative stress (PubMed:25190803). Regulates both the transcriptional activation and repression phases of the circadian clock in a deacetylase activity-independent manner (By similarity). During the activation phase, promotes the accumulation of ubiquitinated ARNTL/BMAL1 at the E-boxes and during the repression phase, blocks FBXL3-mediated CRY1/2 ubiquitination and promotes the interaction of CRY1 and ARNTL/BMAL1 (By similarity). The NCOR1-HDAC3 complex regulates the circadian expression of the core clock gene ARTNL/BMAL1 and the genes involved in lipid metabolism in the liver (By similarity). Serves as a corepressor of RARA, causing its deacetylation and inhibition of RARE DNA element binding (PubMed:28167758). In association with RARA, plays a role in the repression of microRNA-10a and thereby in the inflammatory response (PubMed:28167758).

Tocris Summary for HDAC3 Gene

  • Histone deacetylases (HDACs) are a group of enzymes closely related to sirtuins. They catalyze acetyl group removal from lysine residues in histones and non-histone proteins, causing transcriptional repression. HDACs are usually components of multiprotein complexes.

Gene Wiki entry for HDAC3 Gene

Additional gene information for HDAC3 Gene

No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for HDAC3 Gene

Genomics for HDAC3 Gene

GeneHancer (GH) Regulatory Elements for HDAC3 Gene

Promoters and enhancers for HDAC3 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around HDAC3 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for HDAC3

Top Transcription factor binding sites by QIAGEN in the HDAC3 gene promoter:
  • AP-1
  • AP-2alpha
  • AP-2alpha isoform 2
  • AP-2alpha isoform 3
  • AP-2alpha isoform 4

Genomic Locations for HDAC3 Gene

Genomic Locations for HDAC3 Gene
chr5:141,620,876-141,636,856
(GRCh38/hg38)
Size:
15,981 bases
Orientation:
Minus strand
chr5:141,000,443-141,016,437
(GRCh37/hg19)
Size:
15,995 bases
Orientation:
Minus strand

Genomic View for HDAC3 Gene

Genes around HDAC3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HDAC3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HDAC3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for HDAC3 Gene

Proteins for HDAC3 Gene

  • Protein details for HDAC3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O15379-HDAC3_HUMAN
    Recommended name:
    Histone deacetylase 3
    Protein Accession:
    O15379
    Secondary Accessions:
    • D3DQE1
    • O43268
    • Q9UEI5
    • Q9UEV0

    Protein attributes for HDAC3 Gene

    Size:
    428 amino acids
    Molecular mass:
    48848 Da
    Quaternary structure:
    • Interacts with HDAC7 and HDAC9. Forms a heterologous complex at least with YY1. Interacts with DAXX, HDAC10 and DACH1. Found in a complex with NCOR1 and NCOR2. Component of the N-Cor repressor complex, at least composed of NCOR1, NCOR2, HDAC3, TBL1X, TBL1R, CORO2A and GPS2. Interacts with BCOR, MJD2A/JHDM3A, NRIP1, PRDM6 and SRY. Interacts with BTBD14B. Interacts with GLIS2. Interacts (via the DNA-binding domain) with NR2C1; the interaction recruits phosphorylated NR2C1 to PML bodies for sumoylation. Component of the Notch corepressor complex. Interacts with CBFA2T3 and NKAP. Interacts with APEX1; the interaction is not dependent on the acetylated status of APEX1. Interacts with and deacetylates MAPK14. Interacts with ZMYND15. Interacts with SMRT/NCOR2 and BCL6 on DNA enhancer elements. Interacts with INSM1 (PubMed:10655483, PubMed:10669754, PubMed:10860984, PubMed:10898795, PubMed:11006275, PubMed:11466315, PubMed:11533236, PubMed:11861901, PubMed:14525983, PubMed:14633989, PubMed:15297880, PubMed:15927959, PubMed:16569215, PubMed:18417529, PubMed:19409814, PubMed:23911289). Interacts with XBP1 isoform 1; the interaction occurs in endothelial cell (EC) under disturbed flow (PubMed:25190803). Interacts (via C-terminus) with CCAR2 (via N-terminus). Interacts with and deacetylates MEF2D. Interacts with BEND3. Interacts with NKAPL (By similarity). Interacts with DHX36; this interaction occurs in a RNA-dependent manner (PubMed:18279852). Interacts weakly with CRY1; this interaction is enhanced in the presence of FBXL3 (By similarity). Interacts with FBXL3 and ARNTL/BMAL1 (By similarity). Interacts with NCOR1 (By similarity). Interacts with RARA (PubMed:28167758).

    Three dimensional structures from OCA and Proteopedia for HDAC3 Gene

    Alternative splice isoforms for HDAC3 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for HDAC3 Gene

Selected DME Specific Peptides for HDAC3 Gene

O15379:
  • NMQGFTKSLN
  • QCGADSL
  • YFYDPDVGN
  • LELLKYH
  • DRVMTVSFH
  • HPMKPHR
  • LTHSLVLHYGLYKKM
  • DIDIHHGDGV
  • NEFYDGDHD
  • GGLHHAKK
  • ELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYL
  • VSFHKYG
  • RVLYIDID
  • ASQHDMCRFHSEDYIDFLQ
  • RCWTYET
  • LRDGIDD
  • DRLGCFNL
  • IPLLVLGGGGYTVRNVARCWT

Post-translational modifications for HDAC3 Gene

Other Protein References for HDAC3 Gene

Antibody Products

  • Abcam antibodies for HDAC3

Domains & Families for HDAC3 Gene

Gene Families for HDAC3 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • FDA approved drug targets
  • Predicted intracellular proteins

Protein Domains for HDAC3 Gene

Blocks:
  • Histone deacetylase superfamily signature
  • Histone deacetylase signature
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for HDAC3 Gene

GenScript: Design optimal peptide antigens:
  • Histone deacetylase 3 (B5MGH4_HUMAN)
  • SMAP45 (HDAC3_HUMAN)

Graphical View of Domain Structure for InterPro Entry

O15379

UniProtKB/Swiss-Prot:

HDAC3_HUMAN :
  • Belongs to the histone deacetylase family. HD type 1 subfamily.
Family:
  • Belongs to the histone deacetylase family. HD type 1 subfamily.
genes like me logo Genes that share domains with HDAC3: view

Function for HDAC3 Gene

Molecular function for HDAC3 Gene

UniProtKB/Swiss-Prot Function:
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Participates in the BCL6 transcriptional repressor activity by deacetylating the H3 'Lys-27' (H3K27) on enhancer elements, antagonizing EP300 acetyltransferase activity and repressing proximal gene expression. Probably participates in the regulation of transcription through its binding to the zinc-finger transcription factor YY1; increases YY1 repression activity. Required to repress transcription of the POU1F1 transcription factor. Acts as a molecular chaperone for shuttling phosphorylated NR2C1 to PML bodies for sumoylation (PubMed:21444723, PubMed:23911289). Contributes, together with XBP1 isoform 1, to the activation of NFE2L2-mediated HMOX1 transcription factor gene expression in a PI(3)K/mTORC2/Akt-dependent signaling pathway leading to endothelial cell (EC) survival under disturbed flow/oxidative stress (PubMed:25190803). Regulates both the transcriptional activation and repression phases of the circadian clock in a deacetylase activity-independent manner (By similarity). During the activation phase, promotes the accumulation of ubiquitinated ARNTL/BMAL1 at the E-boxes and during the repression phase, blocks FBXL3-mediated CRY1/2 ubiquitination and promotes the interaction of CRY1 and ARNTL/BMAL1 (By similarity). The NCOR1-HDAC3 complex regulates the circadian expression of the core clock gene ARTNL/BMAL1 and the genes involved in lipid metabolism in the liver (By similarity). Serves as a corepressor of RARA, causing its deacetylation and inhibition of RARE DNA element binding (PubMed:28167758). In association with RARA, plays a role in the repression of microRNA-10a and thereby in the inflammatory response (PubMed:28167758).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]; Xref=Rhea:RHEA:58196, Rhea:RHEA-COMP:9845, Rhea:RHEA-COMP:11338, ChEBI:CHEBI:15377, ChEBI:CHEBI:29969, ChEBI:CHEBI:30089, ChEBI:CHEBI:61930; EC=3.5.1.98;.
UniProtKB/Swiss-Prot Induction:
Up-regulated by disturbed flow in umbilical vein endothelial cells in vitro (PubMed:25190803).
GENATLAS Biochemistry:
histone deacetyltransferase 3,49kDa,ubiquitously expressed,binding to YY1,involved in negative regulation of transcription,modulator of chromatine structure,putatively involved in the pathogenesis of myeloproliferative disorders (potential tumor suppressor)

Enzyme Numbers (IUBMB) for HDAC3 Gene

Phenotypes From GWAS Catalog for HDAC3 Gene

Gene Ontology (GO) - Molecular Function for HDAC3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003682 chromatin binding IDA 16569215
GO:0003714 transcription corepressor activity IMP 12628926
GO:0004407 histone deacetylase activity IEA,TAS 12711221
GO:0005515 protein binding IPI 10898795
GO:0008134 transcription factor binding TAS 12711221
genes like me logo Genes that share ontologies with HDAC3: view
genes like me logo Genes that share phenotypes with HDAC3: view

Animal Models for HDAC3 Gene

MGI Knock Outs for HDAC3:

Animal Model Products

miRNA for HDAC3 Gene

miRTarBase miRNAs that target HDAC3

Clone Products

  • Addgene plasmids for HDAC3

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HDAC3 Gene

Localization for HDAC3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HDAC3 Gene

Nucleus. Cytoplasm. Cytoplasm, cytosol. Note=Colocalizes with XBP1 and AKT1 in the cytoplasm (PubMed:25190803). Predominantly expressed in the nucleus in the presence of CCAR2. {ECO:0000269 PubMed:21030595, ECO:0000269 PubMed:25190803}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HDAC3 gene
Compartment Confidence
plasma membrane 5
cytoskeleton 5
nucleus 5
cytosol 5
golgi apparatus 4
mitochondrion 2
extracellular 1
peroxisome 1
endoplasmic reticulum 1
endosome 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Golgi apparatus (3)
  • Nucleoplasm (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for HDAC3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000118 histone deacetylase complex TAS 12711221
GO:0005634 nucleus TAS 12711221
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm TAS 12711221
GO:0005794 Golgi apparatus IDA --
genes like me logo Genes that share ontologies with HDAC3: view

Pathways & Interactions for HDAC3 Gene

genes like me logo Genes that share pathways with HDAC3: view

Pathways by source for HDAC3 Gene

1 R&D Systems pathway for HDAC3 Gene
16 Qiagen pathways for HDAC3 Gene
  • BRCA1 Pathway
  • Cyclins and Cell Cycle Regulation
  • DNA Methylation and Transcriptional Repression
  • Estrogen Pathway
  • G1-S Phase Transition
1 Cell Signaling Technology pathway for HDAC3 Gene
2 GeneTex pathways for HDAC3 Gene

SIGNOR curated interactions for HDAC3 Gene

Activates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for HDAC3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription by RNA polymerase II IMP 12628926
GO:0001934 positive regulation of protein phosphorylation IDA 25190803
GO:0006325 chromatin organization TAS 12711221
GO:0006476 protein deacetylation IDA 17172643
GO:0007623 circadian rhythm TAS --
genes like me logo Genes that share ontologies with HDAC3: view

Drugs & Compounds for HDAC3 Gene

(67) Drugs for HDAC3 Gene - From: DrugBank, ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Vorinostat Approved, Investigational Pharma Target, inhibitor HDAC inhibitor, Histone deacetylase (HDAC)inhibitors 264
Belinostat Approved, Investigational Pharma Target, inhibitor Histone deacetylase (HDAC)inhibitors 45
Panobinostat Approved, Investigational Pharma Target, inhibitor, Inhibition Histone deacetylase (HDAC)inhibitors 142
Romidepsin Approved, Investigational Pharma inhibitor Histone deacetylase (HDAC)inhibitors 97
Valproic acid Approved, Investigational Pharma inhibitor HDAC1 inhibitor, Histone deacetylase (HDAC)inhibitors 353

(7) Additional Compounds for HDAC3 Gene - From: Novoseek and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Valproic acid, sodium salt
1069-66-5

(3) Tocris Compounds for HDAC3 Gene

Compound Action Cas Number
Apicidin Potent histone deacetylase inhibitor 183506-66-3
PCI 34051 Potent and selective HDAC8 inhibitor 950762-95-5
Valproic acid, sodium salt Histone deacetylase inhibitor 1069-66-5

(36) ApexBio Compounds for HDAC3 Gene

Compound Action Cas Number
2-hexyl-4-Pentynoic Acid Potent and robust HDACs inhibitor 96017-59-3
4SC-202 Class I HDAC inhibitor 1186222-89-8
Apicidin Potent HDAC inhibitor 183506-66-3
AR-42 (OSU-HDAC42) HDAC inhibitor,novel and potent 935881-37-1
Belinostat (PXD101) Hydroxamate-type HDAC inhibitor 414864-00-9
BG45 Novel HDAC3-selective inhibitor 926259-99-6
BML-210(CAY10433) Novel HDAC inhibitor 537034-17-6
Chidamide Novel HDAC inhibitor 743420-02-2
CI994 (Tacedinaline) HDAC inhibitor 112522-64-2
CUDC-101 Multitargeted HDAC inhibitor 1012054-59-9
CUDC-907 Potent PI3K/HDAC inhibitor 1339928-25-4
Droxinostat Selective HDAC inhibitor 99873-43-5
Entinostat (MS-275,SNDX-275) HDAC1 and HDAC3 inhibitor 209783-80-2
ITF2357 (Givinostat) HDAC inhibitor 732302-99-7
KD 5170 HDAC inhibitor 940943-37-3
LAQ824 (NVP-LAQ824,Dacinostat) HDAC inhibitor,potent and novel 404951-53-7
M344 HDAC inhibitor,potent and cell-permeable 251456-60-7
Mocetinostat (MGCD0103, MG0103) HDAC inhibitor,isotype-selective and potent 726169-73-9
NCH 51 Histone deacetylase (HDAC) inhibitor 848354-66-5
NSC 3852 HDAC inhibitor 3565-26-2
Panobinostat (LBH589) HDAC inhibitor 404950-80-7
PCI-24781 (CRA-024781) Pan-HDAC inhibitor 783355-60-2
Pracinostat (SB939) Pan-HDAC inhibitor 929016-96-6
Resminostat (RAS2410) Potent HDAC inhibitor 864814-88-0
Resminostat hydrochloride HDAC inhibitor 1187075-34-8
RG2833 Brain-penetrant HDAC inhibitor 1215493-56-3
RGFP966 Specific HDAC3 inhibitor 1357389-11-7
SBHA HDAC1/HDAC3 inhibitor,cell-permeable 38937-66-5
Scriptaid HDAC inhibitor,novel and cell-permeable 287383-59-9
Sodium Phenylbutyrate Histone deacetylase inhibitor 1716-12-7
Suberohydroxamic Acid HDAC inhibitor 38937-66-5
TC-H 106 HDAC inhibitor 937039-45-7
Trichostatin A (TSA) HDAC inhibitor 58880-19-6
UF 010 Novel and selective class I HDAC inhibitor 537672-41-6
Valproic acid sodium salt (Sodium valproate) HDAC inhibitor 1069-66-5
Vorinostat (SAHA, MK0683) HDAC inhibitor 149647-78-9
genes like me logo Genes that share compounds with HDAC3: view

Transcripts for HDAC3 Gene

mRNA/cDNA for HDAC3 Gene

4 REFSEQ mRNAs :
10 NCBI additional mRNA sequence :
16 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Clone Products

  • Addgene plasmids for HDAC3

Alternative Splicing Database (ASD) splice patterns (SP) for HDAC3 Gene

ExUns: 1a · 1b ^ 2 ^ 3a · 3b · 3c · 3d ^ 4 ^ 5a · 5b ^ 6 ^ 7 ^ 8a · 8b ^ 9 ^ 10a · 10b ^ 11a · 11b ^ 12a · 12b · 12c · 12d ^ 13a · 13b ^ 14 ^
SP1: - - - - -
SP2: - - - -
SP3: - - - - - - - -
SP4: - - - - - - - - -
SP5: - - -
SP6: - -
SP7: - - - - - -
SP8:
SP9: -
SP10:
SP11:
SP12:

ExUns: 15 ^ 16
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:

Relevant External Links for HDAC3 Gene

GeneLoc Exon Structure for
HDAC3

Expression for HDAC3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for HDAC3 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for HDAC3 Gene

This gene is overexpressed in Retina (9.9), Peripheral blood mononuclear cells (9.7), and Monocytes (7.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for HDAC3 Gene



Protein tissue co-expression partners for HDAC3 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for HDAC3

SOURCE GeneReport for Unigene cluster for HDAC3 Gene:

Hs.519632

mRNA Expression by UniProt/SwissProt for HDAC3 Gene:

O15379-HDAC3_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for HDAC3 Gene

  • Blood(4.4)
  • Skin(4.4)
  • Spleen(4.3)
  • Nervous system(2.9)
  • Lung(2.6)
  • Liver(2)
  • Thyroid gland(2)
genes like me logo Genes that share expression patterns with HDAC3: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HDAC3 Gene

Orthologs for HDAC3 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for HDAC3 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia HDAC3 31 30
  • 99.77 (n)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia HDAC3 31
  • 98 (a)
OneToOne
cow
(Bos Taurus)
Mammalia HDAC3 31 30
  • 94.47 (n)
OneToOne
dog
(Canis familiaris)
Mammalia HDAC3 31 30
  • 94.31 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Hdac3 30
  • 92.76 (n)
mouse
(Mus musculus)
Mammalia Hdac3 17 31 30
  • 92.37 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 31
  • 49 (a)
ManyToMany
chicken
(Gallus gallus)
Aves HDAC3 31 30
  • 81.78 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia HDAC3 31
  • 97 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia hdac3 30
  • 79.67 (n)
Str.20485 30
zebrafish
(Danio rerio)
Actinopterygii hdac3 31 30
  • 77.8 (n)
OneToOne
zgc55927 30
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP001143 30
  • 67.45 (n)
fruit fly
(Drosophila melanogaster)
Insecta Hdac3 31 30
  • 66.59 (n)
OneToOne
HDAC3 32
  • 65 (a)
worm
(Caenorhabditis elegans)
Secernentea hda-1 32
  • 54 (a)
hda-2 32
  • 51 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes RPD3 31
  • 55 (a)
OneToMany
HOS2 33
thale cress
(Arabidopsis thaliana)
eudicotyledons HDA9 30
  • 57.77 (n)
Alicante grape
(Vitis vinifera)
eudicotyledons Vvi.2985 30
soybean
(Glycine max)
eudicotyledons Gma.12683 30
rice
(Oryza sativa)
Liliopsida Os04g0409600 30
  • 58.85 (n)
barley
(Hordeum vulgare)
Liliopsida Hv.1657 30
sea squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 70 (a)
OneToOne
Cin.837 30
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.837 30
Species where no ortholog for HDAC3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for HDAC3 Gene

ENSEMBL:
Gene Tree for HDAC3 (if available)
TreeFam:
Gene Tree for HDAC3 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for HDAC3: view image

Paralogs for HDAC3 Gene

(5) SIMAP similar genes for HDAC3 Gene using alignment to 4 proteins:

  • HDAC3_HUMAN
  • B5MGH4_HUMAN
  • E7ESJ6_HUMAN
  • E7EW19_HUMAN
genes like me logo Genes that share paralogs with HDAC3: view

Variants for HDAC3 Gene