Free for academic non-profit institutions. Other users need a Commercial license

Aliases for HDAC3 Gene

Aliases for HDAC3 Gene

  • Histone Deacetylase 3 2 3 5
  • EC 3.5.1.98 4 56
  • RPD3-2 3 4
  • SMAP45 3 4
  • HD3 3 4
  • RPD3 3

External Ids for HDAC3 Gene

Previous GeneCards Identifiers for HDAC3 Gene

  • GC05U990082
  • GC05M140983
  • GC05M141028
  • GC05M140980
  • GC05M136145

Summaries for HDAC3 Gene

Entrez Gene Summary for HDAC3 Gene

  • Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene. [provided by RefSeq, Jul 2008]

GeneCards Summary for HDAC3 Gene

HDAC3 (Histone Deacetylase 3) is a Protein Coding gene. Diseases associated with HDAC3 include Nonsyndromic Deafness. Among its related pathways are PEDF Induced Signaling and Signaling by NOTCH1. Gene Ontology (GO) annotations related to this gene include chromatin binding and hydrolase activity. An important paralog of this gene is HDAC1.

UniProtKB/Swiss-Prot for HDAC3 Gene

  • Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Participates in the BCL6 transcriptional repressor activity by deacetylating the H3 Lys-27 (H3K27) on enhancer elements, antagonizing EP300 acetyltransferase activity and repressing proximal gene expression. Probably participates in the regulation of transcription through its binding to the zinc-finger transcription factor YY1; increases YY1 repression activity. Required to repress transcription of the POU1F1 transcription factor. Acts as a molecular chaperone for shuttling phosphorylated NR2C1 to PML bodies for sumoylation (PubMed:21444723, PubMed:23911289). Contributes, together with XBP1 isoform 1, to the activation of NFE2L2-mediated HMOX1 transcription factor gene expression in a PI(3)K/mTORC2/Akt-dependent signaling pathway leading to endothelial cell (EC) survival under disturbed flow/oxidative stress (PubMed:25190803).

Tocris Summary for HDAC3 Gene

  • Histone deacetylases (HDACs) are a group of enzymes closely related to sirtuins. They catalyze acetyl group removal from lysine residues in histones and non-histone proteins, causing transcriptional repression. HDACs are usually components of multiprotein complexes.

Gene Wiki entry for HDAC3 Gene

Additional gene information for HDAC3 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HDAC3 Gene

Genomics for HDAC3 Gene

GeneHancer (GH) Regulatory Elements for HDAC3 Gene

Promoters and enhancers for HDAC3 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH05I141633 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE 555.8 +0.4 354 5.2 HDGF ARID4B SIN3A FEZF1 IRF4 ZNF213 ZNF143 SP3 SP5 JUNB RELL2 HDAC3 PCDHB19P PCDHGA6 PCDHGB8P PCDHGB6 GC05M141465
GH05I140646 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 26.7 +989.3 989251 2.4 HDGF FOXA2 PKNOX1 SMAD1 ARNT SIN3A DMAP1 ZNF2 YY1 POLR2B NDUFA2 MIR3655 IK ANKHD1 LOC102723915 HDAC3 WDR55 HARS2 SRA1 TMCO6
GH05I141319 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 24.6 +316.2 316220 1.9 PKNOX1 SMAD1 ARNT ARID4B SIN3A ZNF2 YY1 SLC30A9 POLR2B ZNF213 TAF7 PCDHB15 ANKHD1 ENSG00000272108 WDR55 PCDHB9 LOC102723915 FCHSD1 PCDHB18P PCDHB6
GH05I140637 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 24.5 +997.9 997864 2.8 HDGF PKNOX1 SMAD1 FOXA2 ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 TMCO6 HARS2 ANKHD1 WDR55 HDAC3 LOC102723915 SRA1 PURA MALINC1 CD14
GH05I141968 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 23.1 -332.7 -332697 3 HDGF PKNOX1 CLOCK SMAD1 ARNT ARID4B SIN3A DMAP1 ZNF2 ZBTB7B RNF14 PCDH12 PCDHB18P PCDHGA6 PCDHGA7 LOC102723915 HDAC3 KIAA0141 PCDHGA5 PCDHB12
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around HDAC3 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the HDAC3 gene promoter:

Genomic Locations for HDAC3 Gene

Genomic Locations for HDAC3 Gene
chr5:141,620,876-141,636,870
(GRCh38/hg38)
Size:
15,995 bases
Orientation:
Minus strand
chr5:141,000,443-141,016,437
(GRCh37/hg19)

Genomic View for HDAC3 Gene

Genes around HDAC3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HDAC3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HDAC3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for HDAC3 Gene

Proteins for HDAC3 Gene

  • Protein details for HDAC3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O15379-HDAC3_HUMAN
    Recommended name:
    Histone deacetylase 3
    Protein Accession:
    O15379
    Secondary Accessions:
    • D3DQE1
    • O43268
    • Q9UEI5
    • Q9UEV0

    Protein attributes for HDAC3 Gene

    Size:
    428 amino acids
    Molecular mass:
    48848 Da
    Quaternary structure:
    • Interacts with HDAC7 and HDAC9. Forms a heterologous complex at least with YY1. Interacts with DAXX, HDAC10 and DACH1. Found in a complex with NCOR1 and NCOR2. Component of the N-Cor repressor complex, at least composed of NCOR1, NCOR2, HDAC3, TBL1X, TBL1R, CORO2A and GPS2. Interacts with BCOR, MJD2A/JHDM3A, NRIP1, PRDM6 and SRY. Interacts with BTBD14B. Interacts with GLIS2. Interacts (via the DNA-binding domain) with NR2C1; the interaction recruits phosphorylated NR2C1 to PML bodies for sumoylation. Component of the Notch corepressor complex. Interacts with CBFA2T3 and NKAP. Interacts with APEX1; the interaction is not dependent on the acetylated status of APEX1. Interacts with and deacetylates MAPK14. Interacts with ZMYND15. Interacts with SMRT/NCOR2 and BCL6 on DNA enhancer elements. Interacts with INSM1 (PubMed:10655483, PubMed:10669754, PubMed:10860984, PubMed:10898795, PubMed:11006275, PubMed:11466315, PubMed:11533236, PubMed:11861901, PubMed:14525983, PubMed:14633989, PubMed:15297880, PubMed:15927959, PubMed:16569215, PubMed:18417529, PubMed:19409814, PubMed:23911289). Interacts with XBP1 isoform 1; the interaction occurs in endothelial cell (EC) under disturbed flow (PubMed:25190803). Interacts (via C-terminus) with CCAR2 (via N-terminus). Interacts with and deacetylates MEF2D. Interacts with BEND3. Interacts with NKAPL (By similarity).

    Three dimensional structures from OCA and Proteopedia for HDAC3 Gene

    Alternative splice isoforms for HDAC3 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for HDAC3 Gene

Selected DME Specific Peptides for HDAC3 Gene

O15379:
  • NMQGFTKSLN
  • QCGADSL
  • YFYDPDVGN
  • LELLKYH
  • DRVMTVSFH
  • HPMKPHR
  • LTHSLVLHYGLYKKM
  • DIDIHHGDGV
  • NEFYDGDHD
  • GGLHHAKK
  • ELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYL
  • VSFHKYG
  • RVLYIDID
  • ASQHDMCRFHSEDYIDFLQ
  • RCWTYET
  • LRDGIDD
  • DRLGCFNL
  • IPLLVLGGGGYTVRNVARCWT

Post-translational modifications for HDAC3 Gene

Other Protein References for HDAC3 Gene

Domains & Families for HDAC3 Gene

Gene Families for HDAC3 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • FDA approved drug targets
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for HDAC3 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

O15379

UniProtKB/Swiss-Prot:

HDAC3_HUMAN :
  • Belongs to the histone deacetylase family. HD type 1 subfamily.
Family:
  • Belongs to the histone deacetylase family. HD type 1 subfamily.
genes like me logo Genes that share domains with HDAC3: view

Function for HDAC3 Gene

Molecular function for HDAC3 Gene

GENATLAS Biochemistry:
histone deacetyltransferase 3,49kDa,ubiquitously expressed,binding to YY1,involved in negative regulation of transcription,modulator of chromatine structure,putatively involved in the pathogenesis of myeloproliferative disorders (potential tumor suppressor)
UniProtKB/Swiss-Prot CatalyticActivity:
Hydrolysis of an N(6)-acetyl-lysine residue of a histone to yield a deacetylated histone.
UniProtKB/Swiss-Prot Function:
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Participates in the BCL6 transcriptional repressor activity by deacetylating the H3 Lys-27 (H3K27) on enhancer elements, antagonizing EP300 acetyltransferase activity and repressing proximal gene expression. Probably participates in the regulation of transcription through its binding to the zinc-finger transcription factor YY1; increases YY1 repression activity. Required to repress transcription of the POU1F1 transcription factor. Acts as a molecular chaperone for shuttling phosphorylated NR2C1 to PML bodies for sumoylation (PubMed:21444723, PubMed:23911289). Contributes, together with XBP1 isoform 1, to the activation of NFE2L2-mediated HMOX1 transcription factor gene expression in a PI(3)K/mTORC2/Akt-dependent signaling pathway leading to endothelial cell (EC) survival under disturbed flow/oxidative stress (PubMed:25190803).
UniProtKB/Swiss-Prot Induction:
Up-regulated by disturbed flow in umbilical vein endothelial cells in vitro (PubMed:25190803).

Enzyme Numbers (IUBMB) for HDAC3 Gene

Phenotypes From GWAS Catalog for HDAC3 Gene

Gene Ontology (GO) - Molecular Function for HDAC3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003682 chromatin binding IDA 16569215
GO:0003714 transcription corepressor activity IMP 12628926
GO:0004407 histone deacetylase activity IEA,TAS 12711221
GO:0005515 protein binding IPI 10898795
GO:0008134 transcription factor binding TAS 12711221
genes like me logo Genes that share ontologies with HDAC3: view
genes like me logo Genes that share phenotypes with HDAC3: view

Animal Models for HDAC3 Gene

MGI Knock Outs for HDAC3:

Animal Model Products

miRNA for HDAC3 Gene

miRTarBase miRNAs that target HDAC3

Clone Products

  • Addgene plasmids for HDAC3

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HDAC3 Gene

Localization for HDAC3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HDAC3 Gene

Nucleus. Cytoplasm. Cytoplasm, cytosol. Note=Colocalizes with XBP1 and AKT1 in the cytoplasm (PubMed:25190803). Predominantly expressed in the nucleus in the presence of CCAR2. {ECO:0000269 PubMed:21030595, ECO:0000269 PubMed:25190803}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HDAC3 gene
Compartment Confidence
plasma membrane 5
cytoskeleton 5
nucleus 5
cytosol 5
golgi apparatus 5

Subcellular locations from the

Human Protein Atlas (HPA)
  • Golgi apparatus (3)
  • Nucleoplasm (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for HDAC3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000118 histone deacetylase complex TAS 12711221
GO:0005634 nucleus TAS 12711221
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm TAS 12711221
GO:0005794 Golgi apparatus IDA --
genes like me logo Genes that share ontologies with HDAC3: view

Pathways & Interactions for HDAC3 Gene

genes like me logo Genes that share pathways with HDAC3: view

SIGNOR curated interactions for HDAC3 Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for HDAC3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription by RNA polymerase II IMP 12628926
GO:0001934 positive regulation of protein phosphorylation IDA 25190803
GO:0006325 chromatin organization TAS 12711221
GO:0006351 transcription, DNA-templated IEA --
GO:0006355 regulation of transcription, DNA-templated IEA --
genes like me logo Genes that share ontologies with HDAC3: view

Drugs & Compounds for HDAC3 Gene

(67) Drugs for HDAC3 Gene - From: DrugBank, ApexBio, DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Vorinostat Approved, Investigational Pharma Target, inhibitor HDAC inhibitor, Histone deacetylase (HDAC)inhibitors 254
Belinostat Approved, Investigational Pharma Target, inhibitor Histone deacetylase (HDAC)inhibitors 42
Panobinostat Approved, Investigational Pharma Target, inhibitor, Inhibition Histone deacetylase (HDAC)inhibitors 136
Romidepsin Approved, Investigational Pharma inhibitor Histone deacetylase (HDAC)inhibitors 89
Valproic Acid Approved, Investigational Pharma inhibitor HDAC1 inhibitor, Histone deacetylase (HDAC)inhibitors 333

(9) Additional Compounds for HDAC3 Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs

(3) Tocris Compounds for HDAC3 Gene

Compound Action Cas Number
Apicidin Potent histone deacetylase inhibitor 183506-66-3
PCI 34051 Potent and selective HDAC8 inhibitor 950762-95-5
Valproic acid, sodium salt Histone deacetylase inhibitor 1069-66-5

(36) ApexBio Compounds for HDAC3 Gene

Compound Action Cas Number
2-hexyl-4-Pentynoic Acid Potent and robust HDACs inhibitor 96017-59-3
4SC-202 Class I HDAC inhibitor 1186222-89-8
Apicidin Potent HDAC inhibitor 183506-66-3
AR-42 (OSU-HDAC42) HDAC inhibitor,novel and potent 935881-37-1
Belinostat (PXD101) Hydroxamate-type HDAC inhibitor 414864-00-9
BG45 Novel HDAC3-selective inhibitor 926259-99-6
BML-210(CAY10433) Novel HDAC inhibitor 537034-17-6
Chidamide Novel HDAC inhibitor 743420-02-2
CI994 (Tacedinaline) HDAC inhibitor 112522-64-2
CUDC-101 Multitargeted HDAC inhibitor 1012054-59-9
CUDC-907 Potent PI3K/HDAC inhibitor 1339928-25-4
Droxinostat Selective HDAC inhibitor 99873-43-5
Entinostat (MS-275,SNDX-275) HDAC1 and HDAC3 inhibitor 209783-80-2
ITF2357 (Givinostat) HDAC inhibitor 732302-99-7
KD 5170 HDAC inhibitor 940943-37-3
LAQ824 (NVP-LAQ824,Dacinostat) HDAC inhibitor,potent and novel 404951-53-7
M344 HDAC inhibitor,potent and cell-permeable 251456-60-7
Mocetinostat (MGCD0103, MG0103) HDAC inhibitor,isotype-selective and potent 726169-73-9
NCH 51 Histone deacetylase (HDAC) inhibitor 848354-66-5
NSC 3852 HDAC inhibitor 3565-26-2
Panobinostat (LBH589) HDAC inhibitor 404950-80-7
PCI-24781 (CRA-024781) Pan-HDAC inhibitor 783355-60-2
Pracinostat (SB939) Pan-HDAC inhibitor 929016-96-6
Resminostat (RAS2410) Potent HDAC inhibitor 864814-88-0
Resminostat hydrochloride HDAC inhibitor 1187075-34-8
RG2833 Brain-penetrant HDAC inhibitor 1215493-56-3
RGFP966 Specific HDAC3 inhibitor 1357389-11-7
SBHA HDAC1/HDAC3 inhibitor,cell-permeable 38937-66-5
Scriptaid HDAC inhibitor,novel and cell-permeable 287383-59-9
Sodium Phenylbutyrate Histone deacetylase inhibitor 1716-12-7
Suberohydroxamic Acid HDAC inhibitor 38937-66-5
TC-H 106 HDAC inhibitor 937039-45-7
Trichostatin A (TSA) HDAC inhibitor 58880-19-6
UF 010 Novel and selective class I HDAC inhibitor 537672-41-6
Valproic acid sodium salt (Sodium valproate) HDAC inhibitor 1069-66-5
Vorinostat (SAHA, MK0683) HDAC inhibitor 149647-78-9
genes like me logo Genes that share compounds with HDAC3: view

Drug Products

Transcripts for HDAC3 Gene

Unigene Clusters for HDAC3 Gene

Histone deacetylase 3:
Representative Sequences:

Clone Products

  • Addgene plasmids for HDAC3

Alternative Splicing Database (ASD) splice patterns (SP) for HDAC3 Gene

ExUns: 1a · 1b ^ 2 ^ 3a · 3b · 3c · 3d ^ 4 ^ 5a · 5b ^ 6 ^ 7 ^ 8a · 8b ^ 9 ^ 10a · 10b ^ 11a · 11b ^ 12a · 12b · 12c · 12d ^ 13a · 13b ^ 14 ^
SP1: - - - - -
SP2: - - - -
SP3: - - - - - - - -
SP4: - - - - - - - - -
SP5: - - -
SP6: - -
SP7: - - - - - -
SP8:
SP9: -
SP10:
SP11:
SP12:

ExUns: 15 ^ 16
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:

Relevant External Links for HDAC3 Gene

GeneLoc Exon Structure for
HDAC3
ECgene alternative splicing isoforms for
HDAC3

Expression for HDAC3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for HDAC3 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for HDAC3 Gene

This gene is overexpressed in Retina (9.9), Peripheral blood mononuclear cells (9.7), and Monocytes (7.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for HDAC3 Gene



Protein tissue co-expression partners for HDAC3 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of HDAC3 Gene:

HDAC3

SOURCE GeneReport for Unigene cluster for HDAC3 Gene:

Hs.519632

mRNA Expression by UniProt/SwissProt for HDAC3 Gene:

O15379-HDAC3_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for HDAC3 Gene

  • Blood(4.4)
  • Skin(4.4)
  • Spleen(4.3)
  • Nervous system(2.8)
  • Lung(2.5)
  • Thyroid gland(2)
genes like me logo Genes that share expression patterns with HDAC3: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HDAC3 Gene

Orthologs for HDAC3 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for HDAC3 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia HDAC3 33 34
  • 99.77 (n)
oppossum
(Monodelphis domestica)
Mammalia HDAC3 34
  • 98 (a)
OneToOne
cow
(Bos Taurus)
Mammalia HDAC3 33 34
  • 94.47 (n)
dog
(Canis familiaris)
Mammalia HDAC3 33 34
  • 94.31 (n)
rat
(Rattus norvegicus)
Mammalia Hdac3 33
  • 92.76 (n)
mouse
(Mus musculus)
Mammalia Hdac3 33 16 34
  • 92.37 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 34
  • 49 (a)
ManyToMany
chicken
(Gallus gallus)
Aves HDAC3 33 34
  • 81.78 (n)
lizard
(Anolis carolinensis)
Reptilia HDAC3 34
  • 97 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia hdac3 33
  • 79.67 (n)
Str.20485 33
zebrafish
(Danio rerio)
Actinopterygii hdac3 33 34
  • 77.8 (n)
zgc55927 33
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP001143 33
  • 67.45 (n)
fruit fly
(Drosophila melanogaster)
Insecta Hdac3 33 34
  • 66.59 (n)
HDAC3 35
  • 65 (a)
worm
(Caenorhabditis elegans)
Secernentea hda-1 35
  • 54 (a)
hda-2 35
  • 51 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes RPD3 34
  • 55 (a)
OneToMany
HOS2 36
thale cress
(Arabidopsis thaliana)
eudicotyledons HDA9 33
  • 57.77 (n)
soybean
(Glycine max)
eudicotyledons Gma.12683 33
Alicante grape
(Vitis vinifera)
eudicotyledons Vvi.2985 33
rice
(Oryza sativa)
Liliopsida Os04g0409600 33
  • 58.85 (n)
barley
(Hordeum vulgare)
Liliopsida Hv.1657 33
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 70 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.837 33
Species where no ortholog for HDAC3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for HDAC3 Gene

ENSEMBL:
Gene Tree for HDAC3 (if available)
TreeFam:
Gene Tree for HDAC3 (if available)

Paralogs for HDAC3 Gene

Paralogs for HDAC3 Gene

(5) SIMAP similar genes for HDAC3 Gene using alignment to 4 proteins:

genes like me logo Genes that share paralogs with HDAC3: view

Variants for HDAC3 Gene

Sequence variations from dbSNP and Humsavar for HDAC3 Gene

SNP ID Clin Chr 05 pos Variation AA Info Type
rs1000129847 -- 141,627,537(-) C/A/T intron_variant
rs1000388630 -- 141,634,628(-) C/G intron_variant
rs1000405355 -- 141,635,654(-) CAACTCAGGC/C intron_variant
rs1000437456 -- 141,627,344(-) T/C intron_variant
rs1000491299 -- 141,627,095(-) A/G intron_variant

Structural Variations from Database of Genomic Variants (DGV) for HDAC3 Gene

Variant ID Type Subtype PubMed ID
nsv1154058 CNV deletion 26484159
nsv5033 CNV insertion 18451855
nsv516495 CNV gain+loss 19592680

Variation tolerance for HDAC3 Gene

Residual Variation Intolerance Score: 22.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.15; 39.02% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for HDAC3 Gene

Human Gene Mutation Database (HGMD)
HDAC3
SNPedia medical, phenotypic, and genealogical associations of SNPs for
HDAC3

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HDAC3 Gene

Disorders for HDAC3 Gene

MalaCards: The human disease database

(1) MalaCards diseases for HDAC3 Gene - From: GeneCards

Disorder Aliases PubMed IDs
nonsyndromic deafness
  • nonsyndromic hearing loss
- elite association - COSMIC cancer census association via MalaCards
Search HDAC3 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for HDAC3

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with HDAC3: view

No data available for UniProtKB/Swiss-Prot and Genatlas for HDAC3 Gene

Publications for HDAC3 Gene

  1. Differential display cloning of a novel human histone deacetylase (HDAC3) cDNA from PHA-activated immune cells. (PMID: 9464271) Dangond F … Gullans SR (Biochemical and biophysical research communications 1998) 2 3 4 22 58
  2. Characterization of a human RPD3 ortholog, HDAC3. (PMID: 9501169) Emiliani S … Verdin E (Proceedings of the National Academy of Sciences of the United States of America 1998) 2 3 4 22 58
  3. Purification and functional characterization of the human N-CoR complex: the roles of HDAC3, TBL1 and TBLR1. (PMID: 12628926) Yoon HG … Wong J (The EMBO journal 2003) 3 4 22 58
  4. Human HDAC7 histone deacetylase activity is associated with HDAC3 in vivo. (PMID: 11466315) Fischle W … Verdin E (The Journal of biological chemistry 2001) 3 4 22 58
  5. A core SMRT corepressor complex containing HDAC3 and TBL1, a WD40-repeat protein linked to deafness. (PMID: 10809664) Guenther MG … Shiekhattar R (Genes & development 2000) 3 4 22 58

Products for HDAC3 Gene

  • Addgene plasmids for HDAC3