Free for academic non-profit institutions. Other users need a Commercial license
This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a... See more...
Aliases for HDAC2 Gene
Aliases for HDAC2 Gene
External Ids for HDAC2 Gene
- HGNC: 4853
- NCBI Entrez Gene: 3066
- Ensembl: ENSG00000196591
- OMIM®: 605164
- UniProtKB/Swiss-Prot: Q92769
Previous GeneCards Identifiers for HDAC2 Gene
- GC06M114097
- GC06M114284
- GC06M114307
- GC06M114368
- GC06M111834
- GC06M114254
Summaries for HDAC2 Gene
-
This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]
GeneCards Summary for HDAC2 Gene
HDAC2 (Histone Deacetylase 2) is a Protein Coding gene. Diseases associated with HDAC2 include Pulmonary Disease, Chronic Obstructive and Colon Adenoma. Among its related pathways are RNA Polymerase I Promoter Escape and Signaling by GPCR. Gene Ontology (GO) annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is HDAC1.
UniProtKB/Swiss-Prot Summary for HDAC2 Gene
-
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.
-
Histone deacetylases (HDACs) are a group of enzymes closely related to sirtuins. They catalyze acetyl group removal from lysine residues in histones and non-histone proteins, causing transcriptional repression. HDACs are usually components of multiprotein complexes.
Additional gene information for HDAC2 Gene
- HGNC (4853)
- NCBI Entrez Gene (3066)
- Ensembl (ENSG00000196591)
- OMIM® (605164)
- UniProtKB/Swiss-Prot (Q92769)
- Open Targets Platform(ENSG00000196591)
- Monarch Initiative
- Search for HDAC2 at DataMed
- Search for HDAC2 at HumanCyc
No data available for PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for HDAC2 Gene
Genomics for HDAC2 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for HDAC2 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around HDAC2 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for HDAC2
- Top Transcription factor binding sites by QIAGEN in the HDAC2 gene promoter:
-
- AP-1
- ATF-2
- c-Jun
- TBP
- TFIID
Genomic Locations for HDAC2 Gene
Latest Assembly
- chr6:113,933,028-114,011,308
- (GRCh38/hg38)
- Size:
- 78,281 bases
- Orientation:
- Minus strand
Previous Assembly
- chr6:114,254,192-114,292,312
- (GRCh37/hg19 by Entrez Gene)
- Size:
- 38,121 bases
- Orientation:
- Minus strand
- chr6:114,254,192-114,332,472
- (GRCh37/hg19 by Ensembl)
- Size:
- 78,281 bases
- Orientation:
- Minus strand
Genomic View for HDAC2 Gene
Genes around HDAC2 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 6q21 by HGNC
- 6q21 by Entrez Gene
- 6q21 by Ensembl
HDAC2 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for HDAC2 Gene
Proteins for HDAC2 Gene
-
Protein details for HDAC2 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q92769-HDAC2_HUMAN
- Recommended name:
- Histone deacetylase 2
- Protein Accession:
- Q92769
- B3KRS5
- B4DL58
- E1P561
- Q5SRI8
- Q5SZ86
- Q8NEH4
Protein attributes for HDAC2 Gene
- Size:
- 488 amino acids
- Molecular mass:
- 55364 Da
- Quaternary structure:
-
- Part of the core histone deacetylase (HDAC) complex composed of HDAC1, HDAC2, RBBP4 and RBBP7. The core complex associates with MTA2, MBD3, MTA1L1, CHD3 and CHD4 to form the nucleosome remodeling and histone deacetylation (NuRD) complex, or with SIN3, SAP18 and SAP30 to form the SIN3 HDAC complex. Component of a RCOR/GFI/KDM1A/HDAC complex. Interacts directly with GFI1 and GFI1B. Interacts with SNW1, HDAC7, PRDM6, SAP30, SETDB1 and SUV39H1. Interacts with the MACROH2A1 (via the non-histone region). Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B, KDM1A, RCOR1 and PHF21A. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. Part of a complex containing the core histones H2A, H2B, H3 and H4, DEK and unphosphorylated DAXX. Part of a complex containing ATR and CHD4. Forms a heterologous complex at least with YY1. Interacts with ATR, CBFA2T3, DNMT1, MINT, HDAC10, HCFC1, NRIP1, KDM4A and PELP1. Component of a mSin3A corepressor complex that contains SIN3A, SAP130, SUDS3, ARID4B, HDAC1 and HDAC2. Interacts with CHFR and SAP30L. Interacts (CK2 phosphorylated form) with SP3. Interacts with TSHZ3 (via its N-terminus). Interacts with APEX1; the interaction is not dependent on the acetylated status of APEX1. Part of a complex composed of TRIM28, HDAC1, HDAC2 and EHMT2. Interacts with PIMREG. Interacts with BCL6 (non-acetylated form). Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2. Interacts with CRY1, INSM1 and ZNF431. Interacts with NACC2. Interacts with MTA1, with a preference for sumoylated MTA1. Interacts with SIX3 (By similarity). Interacts with BEND3. Component of a histone deacetylase complex containing DNTTIP1, ZNF541, HDAC1 and HDAC2 (PubMed:21573134). Forms a complex comprising APPL1, RUVBL2, APPL2, CTNNB1 and HDAC1 (PubMed:19433865). Interacts with SPHK2 (PubMed:19729656).
- SequenceCaution:
-
- Sequence=AAH31055.2; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305}; Sequence=BAG59420.1; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305};
Three dimensional structures from OCA and Proteopedia for HDAC2 Gene
Protein Expression for HDAC2 Gene
Selected DME Specific Peptides for HDAC2 Gene
- Q92769:
-
- AVVLQCG
- RLFENLRMLPHAPGVQ
- HHGDGVEEAFY
- DIGAGKGK
- KVMEMYQPSA
- HPMKPHR
- DIDIHHGDGV
- LNYGLYR
- GGLHHAKK
- GGSVAGAVKLN
- IRPDNMSEY
- KVCYYYDGD
- DRLGCFNL
- RCWTYET
- NELPYNDYFEYFGPDFKLHISPSNMTNQNT
- QCGADSL
- PDKRISI
- DGIDDESY
- KGHAKCVE
- LELLKYH
- AVKLNRQ
- SDKRIAC
- GGGGYTIRNV
- DRVMTVSFH
- FNVGEDCP
- VSFHKYG
- RVLYIDID
- GEYFPGTG
Post-translational modifications for HDAC2 Gene
- S-nitrosylated by GAPDH. In neurons, S-Nitrosylation at Cys-262 and Cys-274 does not affect the enzyme activity but abolishes chromatin-binding, leading to increases acetylation of histones and activate genes that are associated with neuronal development. In embryonic cortical neurons, S-Nitrosylation regulates dendritic growth and branching.
-
Ubiquitination at Lys11, Lys67, Lys75, Lys243, Lys284, and Lys362
- NX_Q92769 (NX_Q92769-1)
- Modification sites at PhosphoSitePlus
Other Protein References for HDAC2 Gene
Antibodies for research
- LifeSpan BioSciences HDAC2 Antibody (LS-B965) and HDAC2 Antibody (LS-B3907)
- NSJ Bioreagents HDAC2 Antibody
-
Custom Antibody ServicesOriGene Antibodies for HDAC2
- Novus Biologicals Antibodies for HDAC2
-
Abcam antibodies for HDAC2
- Invitrogen Antibodies for HDAC2 (AFLGC-HDAC2)
- antibodies-online: Show 164 available HDAC2 Antibodies ranked by validation data
- Compare Top HDAC2 Antibodies
-
Recommended
- 225 WB Antibodies (anti-human)
- 24 IF (p) Antibodies (anti-human)
- 5 IP Antibodies (anti-human)
- 3 IHC Antibodies (anti-human)
- 1 IHC (p) Antibody (anti-human)
- 132 WB Antibodies (anti-mouse)
- 24 IF (p) Antibodies (anti-mouse)
- 5 IP Antibodies (anti-mouse)
- 3 IHC Antibodies (anti-mouse)
- 1 IHC (p) Antibody (anti-mouse)
- 115 WB Antibodies (anti-rat)
- 24 IF (p) Antibodies (anti-rat)
- 5 IP Antibodies (anti-rat)
- 1 IHC Antibody (anti-rat)
-
Santa Cruz Biotechnology (SCBT) Antibodies for HDAC2
- Sino Biological Antibodies for HDAC2
Protein products for research
-
OriGene Purified Proteins for HDAC2
- Search Origene for MassSpec and Protein Over-expression Lysates for HDAC2
- Origene Custom Protein Services for HDAC2
- ProSpec Recombinant Proteins for HDAC2
-
Abcam proteins for HDAC2
Domains & Families for HDAC2 Gene
Gene Families for HDAC2 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Cancer-related genes
- Enzymes
- FDA approved drug targets
- Plasma proteins
- Predicted intracellular proteins
Protein Domains for HDAC2 Gene
- InterPro:
- Blocks:
-
- Histone deacetylase superfamily signature
- Histone deacetylase signature
- ProtoNet:
Suggested Antigen Peptide Sequences for HDAC2 Gene
- GenScript: Design optimal peptide antigens:
-
- Histone deacetylase (B3KRS5_HUMAN)
- Histone deacetylase 2 (B5MGH3_HUMAN)
- Histone deacetylase 2 (HDAC2_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q92769- Family:
-
- Belongs to the histone deacetylase family. HD type 1 subfamily.
Function for HDAC2 Gene
Molecular function for HDAC2 Gene
- UniProtKB/Swiss-Prot Function:
- Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]; Xref=Rhea:RHEA:58196, Rhea:RHEA-COMP:9845, Rhea:RHEA-COMP:11338, ChEBI:CHEBI:15377, ChEBI:CHEBI:29969, ChEBI:CHEBI:30089, ChEBI:CHEBI:61930; EC=3.5.1.98;.
- GENATLAS Biochemistry:
- histone deacetyltransferase 2,ubiquitously expressed,binding to YY1 for negative regulation of transcription,modulator of chromatin structure
Enzyme Numbers (IUBMB) for HDAC2 Gene
Phenotypes From GWAS Catalog for HDAC2 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0001103 | RNA polymerase II repressing transcription factor binding | IPI | 22926524 |
| GO:0003682 | chromatin binding | ISS | -- |
| GO:0003723 | RNA binding | HDA | 22681889 |
| GO:0004407 | histone deacetylase activity | IEA,IDA | 16642021 |
| GO:0005515 | protein binding | IPI | 9150135 |
Phenotypes for HDAC2 Gene
- MGI mutant phenotypes for HDAC2:
-
inferred from 11 alleles
- normal phenotype
- nervous system phenotype
- muscle phenotype
- homeostasis/metabolism phenotype
- growth/size/body region phenotype
- cellular phenotype
- cardiovascular system phenotype
- behavior/neurological phenotype
- immune system phenotype
- respiratory system phenotype
- mortality/aging
- hematopoietic system phenotype
- neoplasm
- digestive/alimentary phenotype
- endocrine/exocrine gland phenotype
- reproductive system phenotype
- vision/eye phenotype
- limbs/digits/tail phenotype
- skeleton phenotype
- integument phenotype
- pigmentation phenotype
- no phenotypic analysis
- GenomeRNAi human phenotypes for HDAC2:
Animal Models for HDAC2 Gene
Animal Models for research
-
Taconic Biosciences Mouse Models for HDAC2
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for HDAC2 - Starting at $85 >
- * HDAC2 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for HDAC2
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for HDAC2
-
Santa Cruz Biotechnology (SCBT) CRISPR for HDAC2
miRNA for HDAC2 Gene
- miRTarBase miRNAs that target HDAC2
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for HDAC2
- Browse OriGene Inhibitory RNA Products For HDAC2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for HDAC2
Clone products for research
- Applied Biological Materials (abm): Clones for HDAC2 - Starting at $45 >
- * HDAC2 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for HDAC2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for HDAC2
Cell Lines for research
-
Horizon Cell Lines for HDAC2
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HDAC2 Gene
Localization for HDAC2 Gene
Subcellular locations from UniProtKB/Swiss-Prot for HDAC2 Gene
- Nucleus. Cytoplasm.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| mitochondrion | 4 |
| endoplasmic reticulum | 3 |
| cytosol | 3 |
| plasma membrane | 2 |
| extracellular | 2 |
| cytoskeleton | 2 |
| lysosome | 2 |
| peroxisome | 1 |
| endosome | 1 |
| golgi apparatus | 1 |
- Nucleoplasm (3)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000118 | histone deacetylase complex | IBA | 21873635 |
| GO:0000785 | chromatin | HDA | 16217013 |
| GO:0005634 | nucleus | IEA,IDA | 18347167 |
| GO:0005654 | nucleoplasm | TAS | -- |
| GO:0005737 | cytoplasm | TAS | 12711221 |
Pathways & Interactions for HDAC2 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 |
.35
|
|
| 2 | Signaling by NOTCH1 | ||
| 3 | Notch Signaling Pathway (WikiPathways) | ||
| 4 | Development NOTCH1-mediated pathway for NF-KB activity modulation |
Development Notch Signaling Pathway
.55
Development NOTCH1-mediated pathway for NF-KB activity modulation
.55
|
Transcription Sin3 and NuRD in transcription regulation
.31
|
| 5 | Cell cycle |
.58
|
.58
|
Pathways by source for HDAC2 Gene
2 Sino Biological pathways for HDAC2 Gene
13 BioSystems pathways for HDAC2 Gene
33 Reactome pathways for HDAC2 Gene
15 KEGG pathways for HDAC2 Gene
6 GeneGo (Thomson Reuters) pathways for HDAC2 Gene
- Development Notch Signaling Pathway
- Development NOTCH1-mediated pathway for NF-KB activity modulation
- Immune response Function of MEF2 in T lymphocytes
- Transcription Ligand-Dependent Transcription of Retinoid-Target genes
- Transcription Sin3 and NuRD in transcription regulation
1 R&D Systems pathway for HDAC2 Gene
17 Qiagen pathways for HDAC2 Gene
- BRCA1 Pathway
- Calcium Mediated T-Cell Apoptosis
- Cyclins and Cell Cycle Regulation
- DNA Methylation and Transcriptional Repression
- Estrogen Pathway
1 Cell Signaling Technology pathway for HDAC2 Gene
2 GeneTex pathways for HDAC2 Gene
Interacting Proteins for HDAC2 Gene
Selected Interacting proteins:
Q92769-HDAC2_HUMAN
ENSP00000430432
for HDAC2 Gene via
UniProtKB
MINT
STRING
IID
GPS-Prot Interaction Network for HDAC2
SIGNOR curated interactions for HDAC2 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000122 | negative regulation of transcription by RNA polymerase II | IMP | 19041327 |
| GO:0001975 | response to amphetamine | IEA | -- |
| GO:0003300 | cardiac muscle hypertrophy | IEA | -- |
| GO:0006325 | chromatin organization | IEA | -- |
| GO:0006338 | chromatin remodeling | IC | 17827154 |
Drugs & Compounds for HDAC2 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Vorinostat | Approved, Investigational | Pharma | Target, inhibitor | HDAC inhibitor, Histone deacetylase (HDAC)inhibitors | 268 | |
| Romidepsin | Approved, Investigational | Pharma | Target, antagonist, inhibitor | Histone deacetylase (HDAC)inhibitors | 101 | |
| Valproic acid | Approved, Investigational | Pharma | Target, inhibitor | HDAC1 inhibitor, Histone deacetylase (HDAC)inhibitors | 387 | |
| Belinostat | Approved, Investigational | Pharma | Target, inhibitor | Histone deacetylase (HDAC)inhibitors | 50 | |
| Panobinostat | Approved, Investigational | Pharma | Target, inhibitor, Inhibition | Histone deacetylase (HDAC)inhibitors | 145 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| Valproic acid, sodium salt |
|
1069-66-5 |
|
|
(3) Tocris Compounds for HDAC2 Gene
| Compound | Action | Cas Number |
|---|---|---|
| Apicidin | Potent histone deacetylase inhibitor | 183506-66-3 |
| PCI 34051 | Potent and selective HDAC8 inhibitor | 950762-95-5 |
| Valproic acid, sodium salt | Histone deacetylase inhibitor | 1069-66-5 |
(30) ApexBio Compounds for HDAC2 Gene
| Compound | Action | Cas Number |
|---|---|---|
| 2-hexyl-4-Pentynoic Acid | Potent and robust HDACs inhibitor | 96017-59-3 |
| 4SC-202 | Class I HDAC inhibitor | 1186222-89-8 |
| AR-42 (OSU-HDAC42) | HDAC inhibitor,novel and potent | 935881-37-1 |
| Belinostat (PXD101) | Hydroxamate-type HDAC inhibitor | 414864-00-9 |
| BML-210(CAY10433) | Novel HDAC inhibitor | 537034-17-6 |
| BMS-345541(free base) | IKK-1/IKK-2 inhibitor,potent and selective | 445430-58-0 |
| Chidamide | Novel HDAC inhibitor | 743420-02-2 |
| CUDC-907 | Potent PI3K/HDAC inhibitor | 1339928-25-4 |
| Droxinostat | Selective HDAC inhibitor | 99873-43-5 |
| HDAC Set I | ||
| HPOB | HDAC6 inhibitor, potent and selective | 1429651-50-2 |
| ITF2357 (Givinostat) | HDAC inhibitor | 732302-99-7 |
| JNJ-26481585 | Potent HDAC inhibitor | 875320-29-9 |
| LAQ824 (NVP-LAQ824,Dacinostat) | HDAC inhibitor,potent and novel | 404951-53-7 |
| M344 | HDAC inhibitor,potent and cell-permeable | 251456-60-7 |
| Mocetinostat (MGCD0103, MG0103) | HDAC inhibitor,isotype-selective and potent | 726169-73-9 |
| NCH 51 | Histone deacetylase (HDAC) inhibitor | 848354-66-5 |
| NSC 3852 | HDAC inhibitor | 3565-26-2 |
| Panobinostat (LBH589) | HDAC inhibitor | 404950-80-7 |
| Parthenolide | 20554-84-1 | |
| PCI-24781 (CRA-024781) | Pan-HDAC inhibitor | 783355-60-2 |
| Romidepsin (FK228, depsipeptide) | HDAC1/HDAC2 inhibitor,potent and selective | 128517-07-7 |
| Santacruzamate A (CAY10683) | 1477949-42-0 | |
| Sodium Phenylbutyrate | Histone deacetylase inhibitor | 1716-12-7 |
| TC-H 106 | HDAC inhibitor | 937039-45-7 |
| Trichostatin A (TSA) | HDAC inhibitor | 58880-19-6 |
| Tubacin | HDAC6 inhibitor,potent,selective,reversible,cell-permeable | 1350555-93-9 |
| UF 010 | Novel and selective class I HDAC inhibitor | 537672-41-6 |
| Valproic acid sodium salt (Sodium valproate) | HDAC inhibitor | 1069-66-5 |
| Vorinostat (SAHA, MK0683) | HDAC inhibitor | 149647-78-9 |
Transcripts for HDAC2 Gene
mRNA/cDNA for HDAC2 Gene
- 1 REFSEQ mRNAs :
- 14 NCBI additional mRNA sequence :
- 17 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000368632 2084 nts (view in UCSC)
- ENST00000425835 553 nts (view in UCSC)
- ENST00000518690 564 nts (view in UCSC)
- ENST00000518756 826 nts (view in UCSC)
- ENST00000519065 9737 nts (view in UCSC)
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for HDAC2 - Starting at $85 >
- * HDAC2 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for HDAC2
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for HDAC2
-
Santa Cruz Biotechnology (SCBT) CRISPR for HDAC2
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for HDAC2
- Browse OriGene Inhibitory RNA Products For HDAC2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for HDAC2
Clone products for research
- Applied Biological Materials (abm): Clones for HDAC2 - Starting at $45 >
- * HDAC2 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for HDAC2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for HDAC2
| ExUns: | 1a | · | 1b | ^ | 2a | · | 2b | · | 2c | · | 2d | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b | ^ | 8a | · | 8b | ^ | 9a | · | 9b | · | 9c | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16 | ^ | 17 | ^ | 18 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | - | - | - | - |
Relevant External Links for HDAC2 Gene
- GeneLoc Exon Structure for
- HDAC2
Expression for HDAC2 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Spinal Cord (Nervous System)
- Oligodendrocyte Precursor Cells Spinal Cord White Matter
-
Gonad (Reproductive System)
- Primordial Germ Cells Primitive Gonad
-
Hair (Integumentary System)
- Primary Hair Placode Cells Hair Follicle
-
Epithelial Cells
- Primary Hair Placode Cells Hair Follicle
-
Neural Tube (Nervous System)
- Oligodendrocyte Precursor Cells Motor Neural Progenitor Domain
-
Brain (Nervous System)
- Oligodendrocyte Precursor Cells Motor Neural Progenitor Domain
This gene is overexpressed in Lavage (10.6) and Fetal ovary (6.4).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for HDAC2 Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for HDAC2
SOURCE GeneReport for Unigene cluster for HDAC2 Gene:
Hs.3352mRNA Expression by UniProt/SwissProt for HDAC2 Gene:
Q92769-HDAC2_HUMAN
Tissue specificity:
Widely expressed; lower levels in brain and lung.
Evidence on tissue expression from TISSUES for HDAC2 Gene
- Nervous system(4.8)
- Liver(4.6)
- Skin(3.5)
- Muscle(3.4)
- Intestine(3.4)
- Lung(3.4)
- Heart(3.4)
- Kidney(3.4)
- Bone marrow(3.2)
- Lymph node(3.2)
- Spleen(3.2)
- Pancreas(3.2)
- Adrenal gland(3.1)
- Thyroid gland(3.1)
- Stomach(3)
- Blood(2.9)
- Eye(2.2)
Primer products for research
-
OriGene qPCR primer pairs for HDAC2
-
OriGene qPCR primer pairs and template standards for HDAC2
Gene Expression Assays for research
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HDAC2 Gene
Orthologs for HDAC2 Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Platypus (Ornithorhynchus anatinus) |
Mammalia | HDAC2 31 |
|
OneToOne | |
| Chimpanzee (Pan troglodytes) |
Mammalia | HDAC2 30 31 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | HDAC2 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | HDAC2 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | HDAC2 30 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Hdac2 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Hdac2 30 |
|
||
| Chicken (Gallus gallus) |
Aves | HDAC2 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | HDAC2 31 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | hdac2 30 |
|
||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.25023 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | hdac1 30 |
|
||
| Fruit Fly (Drosophila melanogaster) |
Insecta | Rpd3 31 32 |
|
OneToMany | |
| HDAC3 32 |
|
|
|||
| Worm (Caenorhabditis elegans) |
Secernentea | hda-1 30 31 32 |
|
ManyToMany | |
| hda-3 31 |
|
ManyToMany | |||
| hda-2 32 |
|
|
|||
| Baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | RPD3 31 |
|
OneToMany | |
| Thale Cress (Arabidopsis thaliana) |
eudicotyledons | HDA6 30 |
|
||
| Alicante grape (Vitis vinifera) |
eudicotyledons | Vvi.11399 30 |
|
||
| Rice (Oryza sativa) |
Liliopsida | Os08g0344100 30 |
|
||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | CSA.10476 31 |
|
OneToMany | |
| Sea Vase (Ciona intestinalis) |
Ascidiacea | Cin.3554 30 |
|
- Species where no ortholog for HDAC2 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for HDAC2 Gene
- ENSEMBL:
- Gene Tree for HDAC2 (if available)
- TreeFam:
- Gene Tree for HDAC2 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for HDAC2: view image
Paralogs for HDAC2 Gene
Paralogs for HDAC2 Gene
(5) SIMAP similar genes for HDAC2 Gene using alignment to 13 proteins:
- HDAC2_HUMAN
- B3KRS5_HUMAN
- B5MGH3_HUMAN
- E5RFI6_HUMAN
- E5RFP9_HUMAN
- E5RG37_HUMAN
- E5RGV4_HUMAN
- E5RH52_HUMAN
- E5RHE7_HUMAN
- E5RJ04_HUMAN
- E5RK19_HUMAN
- H3BM24_HUMAN
- J3KPW7_HUMAN
Pseudogenes.org Pseudogenes for HDAC2 Gene
Variants for HDAC2 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for HDAC2 Gene
| SNP ID | Clinical significance and condition | Chr 06 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| 977282 | Uncertain Significance: not specified | 113,956,687(-) |
A/G NM_001527.4(HDAC2):c.290T>C (p.Val97Ala) |
MISSENSE_VARIANT,NON_CODING_TRANSCRIPT | |
| 992209 | Uncertain Significance: not specified | 113,956,654(-) |
A/G NM_001527.4(HDAC2):c.323T>C (p.Phe108Ser) |
MISSENSE_VARIANT,NON_CODING_TRANSCRIPT | |
| rs114260386 | Benign: not provided | 113,960,025(-) |
T/C NM_001527.4(HDAC2):c.53-7A>G |
INTRON | |
| rs1554198179 | Uncertain Significance: Inborn genetic diseases | 113,959,978(-) |
C/T NM_001527.4(HDAC2):c.93G>A (p.Met31Ile) |
MISSENSE_VARIANT,NON_CODING_TRANSCRIPT | |
| rs1582482024 | Likely Benign: not provided | 113,948,991(-) |
G/A NM_001527.4(HDAC2):c.829C>T (p.Leu277=) |
NON_CODING_TRANSCRIPT_VARIANT,SYNONYMOUS |
All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).
Residual Variation Intolerance Score:
29.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
5.33;
70.72% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for HDAC2 Gene
SNP Genotyping and Copy Number Assays for research
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HDAC2 Gene
Disorders for HDAC2 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| pulmonary disease, chronic obstructive |
|
|
| colon adenoma |
|
|
| endometrial stromal sarcoma |
|
|
| lung disease |
|
|
| rett syndrome |
|
|
Search HDAC2 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for HDAC2
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- Atlas
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for HDAC2 Gene
Publications for HDAC2 Gene
- Regulation of histone acetylation in the nucleus by sphingosine-1-phosphate. (PMID: 19729656) Hait NC ā¦ Spiegel S (Science (New York, N.Y.) 2009) 3 4 23
- The transcriptional repressor Sp3 is associated with CK2-phosphorylated histone deacetylase 2. (PMID: 12176973) Sun JM ā¦ Davie JR (The Journal of biological chemistry 2002) 3 4 23
- Sharp, an inducible cofactor that integrates nuclear receptor repression and activation. (PMID: 11331609) Shi Y ā¦ Evans RM (Genes & development 2001) 3 4 23
- DNMT1 binds HDAC2 and a new co-repressor, DMAP1, to form a complex at replication foci. (PMID: 10888872) Rountree MR ā¦ Baylin SB (Nature genetics 2000) 3 4 23
- Molecular association between ATR and two components of the nucleosome remodeling and deacetylating complex, HDAC2 and CHD4. (PMID: 10545197) Schmidt DR ā¦ Schreiber SL (Biochemistry 1999) 3 4 23
ExternalLinks
Products for HDAC2 Gene
- Custom Antibody ServicesOriGene Antibodies for HDAC2
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for HDAC2
- Search Origene for MassSpec and Protein Over-expression Lysates for HDAC2
- Origene Custom Protein Services for HDAC2
- Origene shrna, sirna, and RNAi products in human, mouse, rat for HDAC2
- Browse OriGene Inhibitory RNA Products For HDAC2
- OriGene qPCR primer pairs for HDAC2
- OriGene qPCR primer pairs and template standards for HDAC2
- OriGene CRISPR knockouts for HDAC2
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For HDAC2
- Sino Biological Human cDNA Clone for HDAC2
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Sino Biological Antibodies for HDAC2
- Browse Sino Biological Assays
- Browse Antibodies
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for HDAC2
- Novus Biologicals proteins and lysates for HDAC2
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for HDAC2
- Abcam proteins for HDAC2
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for HDAC2
- Taconic Biosciences Mouse Models for HDAC2
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for HDAC2 (AFLGC-HDAC2)
- ApexBio compounds for HDAC2
- VectorBuilder Custom and pre-made DNA vectors for HDAC2 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for HDAC2 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for HDAC2 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for HDAC2 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for HDAC2
- antibodies-online: Show 164 available HDAC2 Antibodies ranked by validation data
- Compare Top HDAC2 Antibodies
- Recommended
- 225 WB Antibodies (anti-human)
- 24 IF (p) Antibodies (anti-human)
- 5 IP Antibodies (anti-human)
- 3 IHC Antibodies (anti-human)
- 1 IHC (p) Antibody (anti-human)
- 132 WB Antibodies (anti-mouse)
- 24 IF (p) Antibodies (anti-mouse)
- 5 IP Antibodies (anti-mouse)
- 3 IHC Antibodies (anti-mouse)
- 1 IHC (p) Antibody (anti-mouse)
- 115 WB Antibodies (anti-rat)
- 24 IF (p) Antibodies (anti-rat)
- 5 IP Antibodies (anti-rat)
- 1 IHC Antibody (anti-rat)
- antibodies-online: Show 50 available HDAC2 Elisa Kits ranked by validation data
- Compare Top HDAC2 Elisa Kits
- antibodies-online: Show 12 available HDAC2 Proteins ranked by validation data
- Compare Top HDAC2 Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for HDAC2
- Search Santa Cruz Biotechnology (SCBT) for HDAC2 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for HDAC2
- Custom Antibody ServicesProSci Antibodies for HDAC2
- Search for HDAC2 Proteins at ProSci
- Horizon Cell Lines for HDAC2
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for HDAC2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for HDAC2
- Search GeneCopoeia for miRNA 3'UTR Target clone products for HDAC2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for HDAC2
Sources for HDAC2 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM® (Updated: 05-Mar-2021)
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59)