Free for academic non-profit institutions. Other users need a Commercial license

HDAC2 Gene(Protein Coding)

Histone Deacetylase 2

GCID:
GC06M113933
GIFtS:
61
Genes Participants
UDN Logo

Aliases for HDAC2 Gene

Aliases for HDAC2 Gene

  • Histone Deacetylase 2 2 3 5
  • EC 3.5.1.98 4 56
  • HD2 3 4
  • Transcriptional Regulator Homolog RPD3 3
  • YY1-Associated Factor 1 3
  • RPD3 3
  • YAF1 3

External Ids for HDAC2 Gene

Previous GeneCards Identifiers for HDAC2 Gene

  • GC06M114097
  • GC06M114284
  • GC06M114307
  • GC06M114368
  • GC06M111834
  • GC06M114254

Summaries for HDAC2 Gene

Entrez Gene Summary for HDAC2 Gene

  • This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

GeneCards Summary for HDAC2 Gene

HDAC2 (Histone Deacetylase 2) is a Protein Coding gene. Diseases associated with HDAC2 include Cerebellar Ataxia, Deafness, And Narcolepsy, Autosomal Dominant and Pulmonary Disease, Chronic Obstructive. Among its related pathways are PEDF Induced Signaling and Signaling by NOTCH1. Gene Ontology (GO) annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is HDAC1.

UniProtKB/Swiss-Prot for HDAC2 Gene

  • Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.

Tocris Summary for HDAC2 Gene

  • Histone deacetylases (HDACs) are a group of enzymes closely related to sirtuins. They catalyze acetyl group removal from lysine residues in histones and non-histone proteins, causing transcriptional repression. HDACs are usually components of multiprotein complexes.

Gene Wiki entry for HDAC2 Gene

Additional gene information for HDAC2 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HDAC2 Gene

Genomics for HDAC2 Gene

Products:

  1. Regulatory Element

GeneHancer (GH) Regulatory Elements for HDAC2 Gene

Promoters and enhancers for HDAC2 Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH06I113968 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 565.2 +40.7 40717 3.2 CLOCK MLX ZFP64 DMAP1 YY1 SLC30A9 ZNF213 ZNF143 SP3 NFYC HDAC2 HDAC2-AS2 RPS27AP11 FLJ34503
GH06I114009 Enhancer 0.4 ENCODE 550.8 +0.4 427 3.2 POU5F1 TCF7L2 HDAC2 HDAC2-AS2
GH06I113854 Promoter/Enhancer 3 UCNEbase EPDnew FANTOM5 Ensembl ENCODE dbSUPER 10.5 +153.5 153488 7.5 HDGF PKNOX1 FOXA2 SMAD1 ARNT ARID4B SIN3A FEZF1 DMAP1 YBX1 MARCKS FLJ34503 RPS27AP11 HDAC2 GC06P113861
GH06I114341 Promoter/Enhancer 1.6 Ensembl ENCODE dbSUPER 13.4 -331.4 -331390 3.1 ARID4B KLF17 SIN3A FEZF1 GLI4 ZNF2 RAD21 ZNF48 RARA ZNF335 HS3ST5 HDAC2 RPS27AP11 GC06M114221 RNA5SP213 HDAC2-AS2
GH06I113994 Enhancer 1.3 Ensembl ENCODE dbSUPER 12.1 +13.6 13558 6.4 PKNOX1 ARID4B GLIS2 ZNF143 FOS REST MIER2 TSHZ1 PPARG KAT8 HDAC2 FLJ34503 HDAC2-AS2
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around HDAC2 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the HDAC2 gene promoter:

Genomic Locations for HDAC2 Gene

Genomic Locations for HDAC2 Gene
chr6:113,933,028-114,011,308
(GRCh38/hg38)
Size:
78,281 bases
Orientation:
Minus strand
chr6:114,254,192-114,332,472
(GRCh37/hg19)

Genomic View for HDAC2 Gene

Genes around HDAC2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HDAC2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HDAC2 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for HDAC2 Gene

Proteins for HDAC2 Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for HDAC2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q92769-HDAC2_HUMAN
    Recommended name:
    Histone deacetylase 2
    Protein Accession:
    Q92769
    Secondary Accessions:
    • B3KRS5
    • B4DL58
    • E1P561
    • Q5SRI8
    • Q5SZ86
    • Q8NEH4

    Protein attributes for HDAC2 Gene

    Size:
    488 amino acids
    Molecular mass:
    55364 Da
    Quaternary structure:
    • Part of the core histone deacetylase (HDAC) complex composed of HDAC1, HDAC2, RBBP4 and RBBP7. The core complex associates with MTA2, MBD3, MTA1L1, CHD3 and CHD4 to form the nucleosome remodeling and histone deacetylation (NuRD) complex, or with SIN3, SAP18 and SAP30 to form the SIN3 HDAC complex. Component of a RCOR/GFI/KDM1A/HDAC complex. Interacts directly with GFI1 and GFI1B. Interacts with SNW1, HDAC7, PRDM6, SAP30, SETDB1 and SUV39H1. Interacts with the H2AFY (via the non-histone region). Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B, KDM1A, RCOR1 and PHF21A. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. Part of a complex containing the core histones H2A, H2B, H3 and H4, DEK and unphosphorylated DAXX. Part of a complex containing ATR and CHD4. Forms a heterologous complex at least with YY1. Interacts with ATR, CBFA2T3, DNMT1, MINT, HDAC10, HCFC1, NRIP1, KDM4A and PELP1. Component of a mSin3A corepressor complex that contains SIN3A, SAP130, SUDS3, ARID4B, HDAC1 and HDAC2. Interacts with CHFR and SAP30L. Interacts (CK2 phosphorylated form) with SP3. Interacts with TSHZ3 (via its N-terminus). Interacts with APEX1; the interaction is not dependent on the acetylated status of APEX1. Part of a complex composed of TRIM28, HDAC1, HDAC2 and EHMT2. Interacts with PIMREG. Interacts with BCL6 (non-acetylated form). Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2. Interacts with CRY1, INSM1 and ZNF431. Interacts with NACC2. Interacts with MTA1, with a preference for sumoylated MTA1. Interacts with SIX3 (By similarity). Interacts with BEND3. Component of a histone deacetylase complex containing DNTTIP1, ZNF541, HDAC1 and HDAC2 (PubMed:21573134).
    SequenceCaution:
    • Sequence=AAH31055.2; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=BAG59420.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for HDAC2 Gene

    Alternative splice isoforms for HDAC2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for HDAC2 Gene

Protein Expression for HDAC2 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for HDAC2 Gene

Q92769:
  • AVVLQCG
  • RLFENLRMLPHAPGVQ
  • HHGDGVEEAFY
  • DIGAGKGK
  • KVMEMYQPSA
  • HPMKPHR
  • DIDIHHGDGV
  • LNYGLYR
  • GGLHHAKK
  • GGSVAGAVKLN
  • IRPDNMSEY
  • KVCYYYDGD
  • DRLGCFNL
  • RCWTYET
  • NELPYNDYFEYFGPDFKLHISPSNMTNQNT
  • QCGADSL
  • PDKRISI
  • DGIDDESY
  • KGHAKCVE
  • LELLKYH
  • AVKLNRQ
  • SDKRIAC
  • GGGGYTIRNV
  • DRVMTVSFH
  • FNVGEDCP
  • VSFHKYG
  • RVLYIDID
  • GEYFPGTG

Post-translational modifications for HDAC2 Gene

  • S-nitrosylated by GAPDH. In neurons, S-Nitrosylation at Cys-262 and Cys-274 does not affect the enzyme activity but abolishes chromatin-binding, leading to increases acetylation of histones and activate genes that are associated with neuronal development. In embryonic cortical neurons, S-Nitrosylation regulates dendritic growth and branching.
  • Ubiquitination at posLast=1111, isoforms=375, posLast=243243, and posLast=284284

Other Protein References for HDAC2 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for HDAC2 Gene

Gene Families for HDAC2 Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • FDA approved drug targets
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for HDAC2 Gene

InterPro:
Blocks:
ProtoNet:

Suggested Antigen Peptide Sequences for HDAC2 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q92769

UniProtKB/Swiss-Prot:

HDAC2_HUMAN :
  • Belongs to the histone deacetylase family. HD type 1 subfamily.
Family:
  • Belongs to the histone deacetylase family. HD type 1 subfamily.
genes like me logo Genes that share domains with HDAC2: view

Function for HDAC2 Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line

Molecular function for HDAC2 Gene

GENATLAS Biochemistry:
histone deacetyltransferase 2,ubiquitously expressed,binding to YY1 for negative regulation of transcription,modulator of chromatin structure
UniProtKB/Swiss-Prot CatalyticActivity:
Hydrolysis of an N(6)-acetyl-lysine residue of a histone to yield a deacetylated histone.
UniProtKB/Swiss-Prot Function:
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.

Enzyme Numbers (IUBMB) for HDAC2 Gene

Gene Ontology (GO) - Molecular Function for HDAC2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000978 contributes_to RNA polymerase II proximal promoter sequence-specific DNA binding HDA,IDA 16217013
GO:0000980 contributes_to RNA polymerase II distal enhancer sequence-specific DNA binding HDA,IDA 16217013
GO:0001047 core promoter binding IEA --
GO:0001103 RNA polymerase II repressing transcription factor binding IPI 22926524
GO:0003682 chromatin binding ISS --
genes like me logo Genes that share ontologies with HDAC2: view
genes like me logo Genes that share phenotypes with HDAC2: view

Animal Models for HDAC2 Gene

MGI Knock Outs for HDAC2:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HDAC2 Gene

Localization for HDAC2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HDAC2 Gene

Nucleus. Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HDAC2 gene
Compartment Confidence
nucleus 5
mitochondrion 4
endoplasmic reticulum 2
cytosol 2
extracellular 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleus (4)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for HDAC2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000785 chromatin IEA --
GO:0000790 nuclear chromatin HDA,IDA 16217013
GO:0005634 nucleus IEA,IDA 18347167
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm TAS 12711221
genes like me logo Genes that share ontologies with HDAC2: view

Pathways & Interactions for HDAC2 Gene

SuperPathways for HDAC2 Gene

PathCards logo More details on SuperPathways for HDAC2
SuperPathway Contained pathways
1 Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
Positive epigenetic regulation of rRNA expression
.86
NoRC negatively regulates rRNA expression
.83
RNA Polymerase I Transcription
.81
Negative epigenetic regulation of rRNA expression
.81
RNA Polymerase I Promoter Clearance
.81
ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression
.76
RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription
.75
Epigenetic regulation of gene expression
.73
HDACs deacetylate histones
.60
Alcoholism
.34
2 Signaling by NOTCH1
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
.78
Constitutive Signaling by NOTCH1 PEST Domain Mutants
.78
Signaling by NOTCH1
.78
Signaling by NOTCH1 HD+PEST Domain Mutants in Cancer
.78
Signaling by NOTCH1 in Cancer
.78
Signaling by NOTCH1 PEST Domain Mutants in Cancer
.78
NOTCH1 Intracellular Domain Regulates Transcription
.68
Signaling by NOTCH
.65
3 Notch signaling pathway (KEGG)
Notch signaling pathway
.83
Notch Signaling Pathway
.83
Notch Signaling Pathway
.41
Notch Signaling Pathways
.31
Notch Signaling
.30
4 p53 Signaling
p53 Pathway
.44
p53 Pathway
.44
p53 Signaling
.44
5 Development NOTCH1-mediated pathway for NF-KB activity modulation
Development Notch Signaling Pathway
.55
Development NOTCH1-mediated pathway for NF-KB activity modulation
.55
Transcription Sin3 and NuRD in transcription regulation
.31
genes like me logo Genes that share pathways with HDAC2: view

SIGNOR curated interactions for HDAC2 Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for HDAC2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription by RNA polymerase II IMP 19041327
GO:0001975 response to amphetamine IEA --
GO:0003300 cardiac muscle hypertrophy IEA --
GO:0006338 chromatin remodeling IC 17827154
GO:0006344 maintenance of chromatin silencing IMP 19372552
genes like me logo Genes that share ontologies with HDAC2: view

Drugs & Compounds for HDAC2 Gene

Products:

  1. Drug

(74) Drugs for HDAC2 Gene - From: DrugBank, ApexBio, DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Vorinostat Approved, Investigational Pharma Target, inhibitor HDAC inhibitor, Histone deacetylase (HDAC)inhibitors 254
Romidepsin Approved, Investigational Pharma Target, antagonist, inhibitor Histone deacetylase (HDAC)inhibitors 89
Valproic Acid Approved, Investigational Pharma Target, inhibitor HDAC1 inhibitor, Histone deacetylase (HDAC)inhibitors 333
Belinostat Approved, Investigational Pharma Target, inhibitor Histone deacetylase (HDAC)inhibitors 42
Panobinostat Approved, Investigational Pharma Target, inhibitor, Inhibition Histone deacetylase (HDAC)inhibitors 136

(12) Additional Compounds for HDAC2 Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs

(3) Tocris Compounds for HDAC2 Gene

Compound Action Cas Number
Apicidin Potent histone deacetylase inhibitor 183506-66-3
PCI 34051 Potent and selective HDAC8 inhibitor 950762-95-5
Valproic acid, sodium salt Histone deacetylase inhibitor 1069-66-5

(31) ApexBio Compounds for HDAC2 Gene

Compound Action Cas Number
2-hexyl-4-Pentynoic Acid Potent and robust HDACs inhibitor 96017-59-3
4SC-202 Class I HDAC inhibitor 1186222-89-8
AR-42 (OSU-HDAC42) HDAC inhibitor,novel and potent 935881-37-1
Belinostat (PXD101) Hydroxamate-type HDAC inhibitor 414864-00-9
BML-210(CAY10433) Novel HDAC inhibitor 537034-17-6
BMS-345541(free base) IKK-1/IKK-2 inhibitor,potent and selective 445430-58-0
Chidamide Novel HDAC inhibitor 743420-02-2
CUDC-907 Potent PI3K/HDAC inhibitor 1339928-25-4
Droxinostat Selective HDAC inhibitor 99873-43-5
HDAC Set I
HPOB HDAC6 inhibitor, potent and selective 1429651-50-2
ITF2357 (Givinostat) HDAC inhibitor 732302-99-7
JNJ-26481585 Potent HDAC inhibitor 875320-29-9
LAQ824 (NVP-LAQ824,Dacinostat) HDAC inhibitor,potent and novel 404951-53-7
M344 HDAC inhibitor,potent and cell-permeable 251456-60-7
Mocetinostat (MGCD0103, MG0103) HDAC inhibitor,isotype-selective and potent 726169-73-9
NCH 51 Histone deacetylase (HDAC) inhibitor 848354-66-5
NSC 3852 HDAC inhibitor 3565-26-2
Panobinostat (LBH589) HDAC inhibitor 404950-80-7
Parthenolide 20554-84-1
PCI-24781 (CRA-024781) Pan-HDAC inhibitor 783355-60-2
Romidepsin (FK228, depsipeptide) HDAC1/HDAC2 inhibitor,potent and selective 128517-07-7
Santacruzamate A (CAY10683) 1477949-42-0
Sodium Phenylbutyrate Histone deacetylase inhibitor 1716-12-7
Suberohydroxamic Acid HDAC inhibitor 38937-66-5
TC-H 106 HDAC inhibitor 937039-45-7
Trichostatin A (TSA) HDAC inhibitor 58880-19-6
Tubacin HDAC6 inhibitor,potent,selective,reversible,cell-permeable 1350555-93-9
UF 010 Novel and selective class I HDAC inhibitor 537672-41-6
Valproic acid sodium salt (Sodium valproate) HDAC inhibitor 1069-66-5
Vorinostat (SAHA, MK0683) HDAC inhibitor 149647-78-9
genes like me logo Genes that share compounds with HDAC2: view

Drug Products

Transcripts for HDAC2 Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone

mRNA/cDNA for HDAC2 Gene

(3) REFSEQ mRNAs :
(8) Additional mRNA sequences :
(267) Selected AceView cDNA sequences:
(17) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for HDAC2 Gene

Histone deacetylase 2:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for HDAC2 Gene

ExUns: 1a · 1b ^ 2a · 2b · 2c · 2d ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8a · 8b ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18
SP1: - - - - - - - -
SP2: - - - - -
SP3: - -
SP4: - - - -
SP5: - -
SP6: -
SP7: - - -
SP8: - - - - - - -

Relevant External Links for HDAC2 Gene

GeneLoc Exon Structure for
HDAC2
ECgene alternative splicing isoforms for
HDAC2

Expression for HDAC2 Gene

Products:

  1. Primer

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for HDAC2 Gene

mRNA expression in normal human tissues for HDAC2 Gene
mRNA expression by GTEx for HDAC2 GenemRNA expression by BioGPS for HDAC2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for HDAC2 Gene

This gene is overexpressed in Lavage (10.6) and Fetal ovary (6.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for HDAC2 Gene



Protein tissue co-expression partners for HDAC2 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of HDAC2 Gene:

HDAC2

SOURCE GeneReport for Unigene cluster for HDAC2 Gene:

Hs.3352

mRNA Expression by UniProt/SwissProt for HDAC2 Gene:

Q92769-HDAC2_HUMAN
Tissue specificity: Widely expressed; lower levels in brain and lung.

Evidence on tissue expression from TISSUES for HDAC2 Gene

  • Nervous system(4.8)
  • Liver(4.5)
  • Lung(3.3)
  • Intestine(3.1)
  • Muscle(3.1)
  • Heart(3)
  • Skin(2.8)
  • Kidney(2.7)
  • Adrenal gland(2.6)
  • Bone marrow(2.6)
  • Lymph node(2.6)
  • Blood(2.5)
  • Pancreas(2.3)
  • Spleen(2.3)
  • Stomach(2.3)
  • Thyroid gland(2.3)
genes like me logo Genes that share expression patterns with HDAC2: view

Primer Products

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HDAC2 Gene

Orthologs for HDAC2 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for HDAC2 Gene

Organism Taxonomy Gene Similarity Type Details
platypus
(Ornithorhynchus anatinus)
 Mammalia HDAC2 34
  • 100 (a)
 OneToOne
chimpanzee
(Pan troglodytes)
 Mammalia HDAC2 33 34
  • 99.86 (n)
oppossum
(Monodelphis domestica)
 Mammalia HDAC2 34
  • 99 (a)
 OneToOne
dog
(Canis familiaris)
 Mammalia HDAC2 34 33
  • 94.39 (n)
 OneToOne
cow
(Bos Taurus)
 Mammalia HDAC2 34 33
  • 93.99 (n)
 OneToOne
mouse
(Mus musculus)
 Mammalia Hdac2 33 16 34
  • 91.6 (n)
rat
(Rattus norvegicus)
 Mammalia Hdac2 33
  • 89.69 (n)
chicken
(Gallus gallus)
 Aves HDAC2 33 34
  • 85.66 (n)
lizard
(Anolis carolinensis)
 Reptilia HDAC2 34
  • 98 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia hdac2 33
  • 82.65 (n)
African clawed frog
(Xenopus laevis)
 Amphibia Xl.25023 33
zebrafish
(Danio rerio)
 Actinopterygii hdac1 33
  • 75.49 (n)
fruit fly
(Drosophila melanogaster)
 Insecta Rpd3 35 34
  • 79 (a)
HDAC3 35
  • 57 (a)
worm
(Caenorhabditis elegans)
 Secernentea hda-1 35 33 34
  • 62.86 (n)
hda-3 34
  • 60 (a)
 ManyToMany
hda-2 35
  • 48 (a)
baker's yeast
(Saccharomyces cerevisiae)
 Saccharomycetes RPD3 34
  • 60 (a)
 OneToMany
thale cress
(Arabidopsis thaliana)
 eudicotyledons HDA6 33
  • 61.5 (n)
Alicante grape
(Vitis vinifera)
 eudicotyledons Vvi.11399 33
rice
(Oryza sativa)
 Liliopsida Os08g0344100 33
  • 58.87 (n)
sea squirt
(Ciona savignyi)
 Ascidiacea CSA.10476 34
  • 82 (a)
 OneToMany
sea squirt
(Ciona intestinalis)
 Ascidiacea Cin.3554 33
Species where no ortholog for HDAC2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for HDAC2 Gene

ENSEMBL:
Gene Tree for HDAC2 (if available)
TreeFam:
Gene Tree for HDAC2 (if available)

Paralogs for HDAC2 Gene

Paralogs for HDAC2 Gene

(5) SIMAP similar genes for HDAC2 Gene using alignment to 13 proteins:

Pseudogenes.org Pseudogenes for HDAC2 Gene

genes like me logo Genes that share paralogs with HDAC2: view

Variants for HDAC2 Gene

Sequence variations from dbSNP and Humsavar for HDAC2 Gene

SNP ID Clin Chr 06 pos Variation AA Info Type
rs1000022111 -- 113,958,305(-) G/A intron_variant
rs1000053525 -- 113,946,406(-) T/TT intron_variant
rs1000074788 -- 113,947,052(-) C/T intron_variant
rs1000120100 -- 113,941,583(-) C/A intron_variant
rs1000191206 -- 113,936,445(-) T/C 3_prime_UTR_variant, genic_downstream_transcript_variant, non_coding_transcript_variant

Structural Variations from Database of Genomic Variants (DGV) for HDAC2 Gene

Variant ID Type Subtype PubMed ID
nsv520419 CNV loss 19592680
nsv474109 CNV novel sequence insertion 20440878
esv2732596 CNV deletion 23290073

Variation tolerance for HDAC2 Gene

Residual Variation Intolerance Score: 29.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.33; 70.72% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for HDAC2 Gene

Human Gene Mutation Database (HGMD)
HDAC2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
HDAC2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HDAC2 Gene

Disorders for HDAC2 Gene

MalaCards: The human disease database

(2) MalaCards diseases for HDAC2 Gene - From: HGMD, DISEASES, and Novoseek

- elite association - COSMIC cancer census association via MalaCards
Search HDAC2 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for HDAC2

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with HDAC2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for HDAC2 Gene

Publications for HDAC2 Gene

  1. The transcriptional repressor Sp3 is associated with CK2-phosphorylated histone deacetylase 2. (PMID: 12176973) Sun JM … Davie JR (The Journal of biological chemistry 2002) 3 4 22 58
  2. DNMT1 binds HDAC2 and a new co-repressor, DMAP1, to form a complex at replication foci. (PMID: 10888872) Rountree MR … Baylin SB (Nature genetics 2000) 3 4 22 58
  3. Molecular association between ATR and two components of the nucleosome remodeling and deacetylating complex, HDAC2 and CHD4. (PMID: 10545197) Schmidt DR … Schreiber SL (Biochemistry 1999) 3 4 22 58
  4. Human histone deacetylase 2, HDAC2 (Human RPD3), is localized to 6q21 by radiation hybrid mapping. (PMID: 9782097) Betz R … Ekström TJ (Genomics 1998) 2 3 22 58
  5. The subcellular distribution and function of MTA1 in cancer differentiation. (PMID: 24970816) Liu J … Qian H (Oncotarget 2014) 3 4 58

Products for HDAC2 Gene

Sources for HDAC2 Gene

Content
Loading form....