Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in... See more...

Aliases for HDAC1 Gene

Aliases for HDAC1 Gene

  • Histone Deacetylase 1 2 3 4 5
  • EC 3.5.1.98 4 54
  • RPD3L1 3 4
  • HD1 3 4
  • Reduced Potassium Dependency, Yeast Homolog-Like 1 3
  • GON-10 3
  • KDAC1 3
  • RPD3 3

External Ids for HDAC1 Gene

Previous HGNC Symbols for HDAC1 Gene

  • RPD3L1

Previous GeneCards Identifiers for HDAC1 Gene

  • GC01P032525
  • GC01P031697
  • GC01P032184
  • GC01P032260
  • GC01P032426
  • GC01P032757
  • GC01P030873

Summaries for HDAC1 Gene

Entrez Gene Summary for HDAC1 Gene

  • Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq, Jul 2008]

GeneCards Summary for HDAC1 Gene

HDAC1 (Histone Deacetylase 1) is a Protein Coding gene. Diseases associated with HDAC1 include Atrichia With Papular Lesions and Rett Syndrome. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Retinoic acid receptors-mediated signaling. Gene Ontology (GO) annotations related to this gene include DNA-binding transcription factor activity and transcription factor binding. An important paralog of this gene is HDAC2.

UniProtKB/Swiss-Prot Summary for HDAC1 Gene

  • Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates 'Lys-310' in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation.

Tocris Summary for HDAC1 Gene

  • Histone deacetylases (HDACs) are a group of enzymes closely related to sirtuins. They catalyze acetyl group removal from lysine residues in histones and non-histone proteins, causing transcriptional repression. HDACs are usually components of multiprotein complexes.

Gene Wiki entry for HDAC1 Gene

Additional gene information for HDAC1 Gene

No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for HDAC1 Gene

Genomics for HDAC1 Gene

GeneHancer (GH) Regulatory Elements for HDAC1 Gene

Promoters and enhancers for HDAC1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH01J032289 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE CraniofacialAtlas 763.7 -0.6 -579 4.2 ZNF785 ZBTB40 SP1 CTCF SIX5 ZBTB6 SMARCE1 POLR2A FOS CREB1 HDAC1 RF00017-148 SNRNP40 RBBP4 KHDRBS1 TXLNA TSSK3 IQCC ENSG00000224066 TMEM39B
GH01J032329 Promoter/Enhancer 0.5 EPDnew dbSUPER 750.3 +37.3 37317 0.1 HDAC1 MARCKSL1 lnc-MARCKSL1-1
GH01J031924 Promoter/Enhancer 2.4 FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 21.9 -356.3 -356250 22.1 GTF3C2 ZNF785 SIN3A ZNF24 SP1 ZBTB40 CTCF SREBF1 SIX5 ZBTB6 SNRNP40 RBBP4 TXLNA KHDRBS1 ENSG00000229447 TSSK3 PUM1 TMEM39B ZBTB8A EIF3I
GH01J032390 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE CraniofacialAtlas 21.6 +101.2 101219 5.8 ZBTB40 SP1 FOXA1 SMARCE1 RBPJ POLR2A HDAC2 NR2F1 NR2F6 ATF1 BSDC1 lnc-FAM229A-3 lnc-TSSK3-5 RBBP4 TSSK3 KHDRBS1 TXLNA KPNA6 TMEM39B FAM229A
GH01J032648 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE CraniofacialAtlas 21 +358.9 358918 4.8 ZNF785 ZBTB40 SP1 SREBF1 SIX5 MLX POLR2A USF2 ATF1 FOS RBBP4 ZBTB8OS lnc-ZBTB8OS-3 TXLNA ZBTB8A KHDRBS1 TSSK3 TMEM39B ZSCAN20 AK2
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around HDAC1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the HDAC1 gene promoter:
  • AML1a

Genomic Locations for HDAC1 Gene

Genomic Locations for HDAC1 Gene
chr1:32,292,083-32,333,635
(GRCh38/hg38)
Size:
41,553 bases
Orientation:
Plus strand
chr1:32,757,687-32,799,236
(GRCh37/hg19)
Size:
41,550 bases
Orientation:
Plus strand

Genomic View for HDAC1 Gene

Genes around HDAC1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HDAC1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HDAC1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for HDAC1 Gene

Proteins for HDAC1 Gene

  • Protein details for HDAC1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q13547-HDAC1_HUMAN
    Recommended name:
    Histone deacetylase 1
    Protein Accession:
    Q13547
    Secondary Accessions:
    • Q92534

    Protein attributes for HDAC1 Gene

    Size:
    482 amino acids
    Molecular mass:
    55103 Da
    Quaternary structure:
    • Part of the core histone deacetylase (HDAC) complex composed of HDAC1, HDAC2, RBBP4 and RBBP7. The core complex associates with MTA2, MBD2, MBD3, MTA1L1, CHD3 and CHD4 to form the nucleosome remodeling and histone deacetylation (NuRD) complex, or with SIN3, SAP18 and SAP30 to form the SIN3 HDAC complex. Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. Component of a mSin3A corepressor complex that contains SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1 and HDAC2. Found in a trimeric complex with APBB1 and TSHZ3; the interaction between HDAC1 and APBB1 is mediated by TSHZ3. Component of a RCOR/GFI/KDM1A/HDAC complex. Part of a complex composed of TRIM28, HDAC1, HDAC2 and EHMT2. Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2. The large PER complex involved in the histone deacetylation is composed of at least HDAC1, PER2, SFPQ and SIN3A. Associates with the 9-1-1 complex; interacts with HUS1. Found in a complex with DNMT3A and HDAC7. Interacts with the non-histone region of H2AFY. Interacts with TRIM28; the interaction recruits HDAC1 to E2F1 and inhibits its acetylation. Interacts with SP1; the interaction deacetylates SP1 and regulates its transcriptional activity. Interacts with SP3; the interaction deacetylates SP3 and regulates its transcriptional activity. In vitro, C(18) ceramides increase this interaction and the subsequent SP3 deacetylation and SP3-mediated repression of the TERT promoter. Interacts with TSHZ3 (via N-terminus); the interaction is direct. Interacts with APEX1; the interaction is not dependent on the acetylated status of APEX1. Interacts with C10orf90/FATS (via its N-terminal); the interaction prevents binding of HDAC1 to CDKN1A/p21 and facilitates the acetylation and stabilization of CDKN1A/p21. Interacts with CDKN1A/p21. Interacts with CDK5 complexed to CDK5R1 (p25). Interacts directly with GFI1 and GFI1B. Interacts with NR1D2 (via C-terminus). Interacts with TSC22D3 isoform 1; this interaction affects HDAC1 activity on MYOG promoter and thus inhibits MYOD1 transcriptional activity. Interacts with BAZ2A/TIP5, BANP, BCL6, BCOR, BHLHE40/DEC1, BRMS1, BRMS1L, CBFA2T3, CHFR, CIART, CRY1, DAXX, DDIT3/CHOP, DDX5, DNMT1, E4F1, EP300, HCFC1, HDAC9, INSM1, NFE4, NR4A2/NURR1, MIER1, KDM4A, KDM5B, KLF1, MINT, NRIP1, PCAF, PHB2, PRDM6, PRDM16, RB1, RERE, SAMSN1, SAP30L, SETDB1, SMAD3, SMARCA4/BRG1, SMYD2, SUV39H1, TGIF, TGIF2, TRAF6, UHRF1, UHRF2, ZMYND15, ZNF431 and ZNF541. Interacts with KDM5A (By similarity). Interacts with DNTTIP1 (PubMed:25653165). Identified in a histone deacetylase complex that contains DNTTIP1, HDAC1 and ELMSAN1; this complex assembles into a tetramer that contains four copies of each protein chain (PubMed:25653165). Interacts with CCAR2 (PubMed:21030595). Interacts with PPHLN1 (PubMed:17963697). Found in a complex with YY1, SIN3A and GON4L (By similarity). Interacts with CHD4 (PubMed:27616479). Found in a complex composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1. Interacts with SIN3A (By similarity). Interacts with DHX36; this interaction occurs in a RNA-dependent manner (PubMed:18279852). Interacts with ZBTB7A (PubMed:25514493). Interacts with SMAD4; positively regulated by ZBTB7A (PubMed:25514493). Interacts with PACS2 (PubMed:29656858). Forms a complex comprising APPL1, RUVBL2, APPL2, CTNNB1 and HDAC2 (PubMed:19433865). Interacts with ZNF638 (PubMed:30487602). Interacts with SPHK2 (PubMed:19729656).

    Three dimensional structures from OCA and Proteopedia for HDAC1 Gene

neXtProt entry for HDAC1 Gene

Selected DME Specific Peptides for HDAC1 Gene

Q13547:
  • AVVLQCG
  • RLFENLRMLPHAPGVQ
  • HHGDGVEEAFY
  • DIGAGKGK
  • HPMKPHR
  • DIDIHHGDGV
  • LNYGLYR
  • GGLHHAKK
  • FVKSFNLPM
  • IRPDNMSEY
  • KVCYYYDGD
  • DRLGCFNL
  • LRDGIDD
  • RCWTYET
  • NELPYNDYFEYFGPDFKLHISPSNMTNQNT
  • PDKRISI
  • DGIDDESY
  • KGHAKCVE
  • EYLEKIK
  • LELLKYH
  • SDKRIAC
  • GGGGYTIRNV
  • DRVMTVSFH
  • NFKKAKRVKTE
  • FNVGEDCP
  • VSFHKYG
  • RVLYIDID
  • AVKLNKQ
  • GEYFPGTG

Post-translational modifications for HDAC1 Gene

  • Sumoylated on Lys-444 and Lys-476; which promotes enzymatic activity. Desumoylated by SENP1.
  • Phosphorylation on Ser-421 and Ser-423 promotes enzymatic activity and interactions with NuRD and SIN3 complexes. Phosphorylated by CDK5.
  • Ubiquitinated by CHFR, leading to its degradation by the proteasome. Ubiquitinated by KCTD11, leading to proteasomal degradation.
  • Ubiquitination at Lys10, Lys66, Lys74, Lys126, Lys279, and Lys361
  • Modification sites at PhosphoSitePlus

Other Protein References for HDAC1 Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibody Products

  • Abcam antibodies for HDAC1

Domains & Families for HDAC1 Gene

Gene Families for HDAC1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • FDA approved drug targets
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for HDAC1 Gene

GenScript: Design optimal peptide antigens:
  • Histone deacetylase (B5BU61_HUMAN)
  • Histone deacetylase 1 (B5MGH2_HUMAN)
  • Histone deacetylase 1 (HDAC1_HUMAN)
  • Histone deacetylase (Q6IT96_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q13547

UniProtKB/Swiss-Prot:

HDAC1_HUMAN :
  • Belongs to the histone deacetylase family. HD type 1 subfamily.
Family:
  • Belongs to the histone deacetylase family. HD type 1 subfamily.
genes like me logo Genes that share domains with HDAC1: view

Function for HDAC1 Gene

Molecular function for HDAC1 Gene

UniProtKB/Swiss-Prot Function:
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates 'Lys-310' in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=Hydrolysis of an N(6)-acetyl-lysine residue of a histone to yield a deacetylated histone.; EC=3.5.1.98;.
GENATLAS Biochemistry:
histone deacetyltransferase 1,modulator of chromatin structure,involved in repression of gene expression,through interaction with RB1,also downregulating MEF2 activity after being recruited by MITR

Enzyme Numbers (IUBMB) for HDAC1 Gene

Phenotypes From GWAS Catalog for HDAC1 Gene

Gene Ontology (GO) - Molecular Function for HDAC1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000976 transcription regulatory region sequence-specific DNA binding IEA,ISS --
GO:0000978 RNA polymerase II proximal promoter sequence-specific DNA binding IGI 18974119
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding IDA 19057576
GO:0000980 contributes_to RNA polymerase II distal enhancer sequence-specific DNA binding HDA 16217013
GO:0001046 core promoter sequence-specific DNA binding IDA 23629966
genes like me logo Genes that share ontologies with HDAC1: view
genes like me logo Genes that share phenotypes with HDAC1: view

Animal Models for HDAC1 Gene

MGI Knock Outs for HDAC1:
  • Hdac1 Hdac1<tm1b(EUCOMM)Wtsi>
  • Hdac1 Hdac1<tm1a(EUCOMM)Wtsi>
  • Hdac1 Hdac1<tm1Sei>
  • Hdac1 Hdac1<tm1.2Eno>
  • Hdac1 Hdac1<tm1.2Pmt>

Animal Model Products

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for HDAC1

Clone Products

  • Addgene plasmids for HDAC1

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HDAC1 Gene

Localization for HDAC1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HDAC1 Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HDAC1 gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 1
extracellular 1
cytoskeleton 1
mitochondrion 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for HDAC1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000118 histone deacetylase complex TAS 12711221
GO:0000785 chromatin IDA 16731528
GO:0000790 nuclear chromatin IEA,IDA 22926524
GO:0000792 heterochromatin IEA --
GO:0005634 nucleus IEA,IDA 10846170
genes like me logo Genes that share ontologies with HDAC1: view

Pathways & Interactions for HDAC1 Gene

PathCards logo

SuperPathways for HDAC1 Gene

SuperPathway Contained pathways
1 Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
2 Signaling by NOTCH1
3 Notch Signaling Pathway (WikiPathways)
4 Transcriptional activity of SMAD2/SMAD3-SMAD4 heterotrimer
5 p53 Signaling
.44
genes like me logo Genes that share pathways with HDAC1: view

Pathways by source for HDAC1 Gene

SIGNOR curated interactions for HDAC1 Gene

Gene Ontology (GO) - Biological Process for HDAC1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription by RNA polymerase II IEA,TAS --
GO:0006325 chromatin organization TAS 12711221
GO:0006338 chromatin remodeling IC 16762839
GO:0006346 methylation-dependent chromatin silencing IGI 23770133
GO:0006357 regulation of transcription by RNA polymerase II IGI 19057576
genes like me logo Genes that share ontologies with HDAC1: view

Drugs & Compounds for HDAC1 Gene

(91) Drugs for HDAC1 Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Romidepsin Approved, Investigational Pharma Target, antagonist, inhibitor Histone deacetylase (HDAC)inhibitors 96
Valproic acid Approved, Investigational Pharma inhibitor HDAC1 inhibitor, Histone deacetylase (HDAC)inhibitors 352
Belinostat Approved, Investigational Pharma Target, inhibitor Histone deacetylase (HDAC)inhibitors 44
Panobinostat Approved, Investigational Pharma Target, inhibitor, Inhibition Histone deacetylase (HDAC)inhibitors 140
Vorinostat Approved, Investigational Pharma Target, inhibitor HDAC inhibitor, Histone deacetylase (HDAC)inhibitors 263

(17) Additional Compounds for HDAC1 Gene - From: Novoseek and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Valproic acid, sodium salt
1069-66-5

(3) Tocris Compounds for HDAC1 Gene

Compound Action Cas Number
Apicidin Potent histone deacetylase inhibitor 183506-66-3
PCI 34051 Potent and selective HDAC8 inhibitor 950762-95-5
Valproic acid, sodium salt Histone deacetylase inhibitor 1069-66-5

(43) ApexBio Compounds for HDAC1 Gene

Compound Action Cas Number
2-hexyl-4-Pentynoic Acid Potent and robust HDACs inhibitor 96017-59-3
4SC-202 Class I HDAC inhibitor 1186222-89-8
AR-42 (OSU-HDAC42) HDAC inhibitor,novel and potent 935881-37-1
Belinostat (PXD101) Hydroxamate-type HDAC inhibitor 414864-00-9
BML-210(CAY10433) Novel HDAC inhibitor 537034-17-6
BMS-345541(free base) IKK-1/IKK-2 inhibitor,potent and selective 445430-58-0
Chidamide Novel HDAC inhibitor 743420-02-2
CI994 (Tacedinaline) HDAC inhibitor 112522-64-2
CUDC-101 Multitargeted HDAC inhibitor 1012054-59-9
CUDC-907 Potent PI3K/HDAC inhibitor 1339928-25-4
Droxinostat Selective HDAC inhibitor 99873-43-5
Entinostat (MS-275,SNDX-275) HDAC1 and HDAC3 inhibitor 209783-80-2
HDAC Set I
HPOB HDAC6 inhibitor, potent and selective 1429651-50-2
ITF2357 (Givinostat) HDAC inhibitor 732302-99-7
JNJ-26481585 Potent HDAC inhibitor 875320-29-9
KD 5170 HDAC inhibitor 940943-37-3
LAQ824 (NVP-LAQ824,Dacinostat) HDAC inhibitor,potent and novel 404951-53-7
M344 HDAC inhibitor,potent and cell-permeable 251456-60-7
Mocetinostat (MGCD0103, MG0103) HDAC inhibitor,isotype-selective and potent 726169-73-9
NCH 51 Histone deacetylase (HDAC) inhibitor 848354-66-5
NSC 3852 HDAC inhibitor 3565-26-2
Panobinostat (LBH589) HDAC inhibitor 404950-80-7
Parthenolide 20554-84-1
PCI-24781 (CRA-024781) Pan-HDAC inhibitor 783355-60-2
Pracinostat (SB939) Pan-HDAC inhibitor 929016-96-6
Pyroxamide HDAC1 inhibitor 382180-17-8
Resminostat (RAS2410) Potent HDAC inhibitor 864814-88-0
Resminostat hydrochloride HDAC inhibitor 1187075-34-8
RG2833 Brain-penetrant HDAC inhibitor 1215493-56-3
Romidepsin (FK228, depsipeptide) HDAC1/HDAC2 inhibitor,potent and selective 128517-07-7
Santacruzamate A (CAY10683) 1477949-42-0
SBHA HDAC1/HDAC3 inhibitor,cell-permeable 38937-66-5
Scriptaid HDAC inhibitor,novel and cell-permeable 287383-59-9
Sodium Phenylbutyrate Histone deacetylase inhibitor 1716-12-7
Suberohydroxamic Acid HDAC inhibitor 38937-66-5
TC-H 106 HDAC inhibitor 937039-45-7
Trichostatin A (TSA) HDAC inhibitor 58880-19-6
Tubacin HDAC6 inhibitor,potent,selective,reversible,cell-permeable 1350555-93-9
UF 010 Novel and selective class I HDAC inhibitor 537672-41-6
Valproic acid HDAC1 inhibitor 99-66-1
Valproic acid sodium salt (Sodium valproate) HDAC inhibitor 1069-66-5
Vorinostat (SAHA, MK0683) HDAC inhibitor 149647-78-9
genes like me logo Genes that share compounds with HDAC1: view

Transcripts for HDAC1 Gene

mRNA/cDNA for HDAC1 Gene

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for HDAC1

Clone Products

  • Addgene plasmids for HDAC1

Alternative Splicing Database (ASD) splice patterns (SP) for HDAC1 Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6a · 6b · 6c ^ 7 ^ 8a · 8b ^ 9a · 9b · 9c · 9d ^ 10a · 10b · 10c ^ 11a · 11b ^ 12a · 12b · 12c ^ 13 ^ 14 ^
SP1: - - - - - -
SP2:
SP3: - - -
SP4: - - -
SP5: - -
SP6:
SP7: -
SP8: - -
SP9:

ExUns: 15
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:

Relevant External Links for HDAC1 Gene

GeneLoc Exon Structure for
HDAC1
ECgene alternative splicing isoforms for
HDAC1

Expression for HDAC1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for HDAC1 Gene

Protein differential expression in normal tissues from HIPED for HDAC1 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (12.1) and Lymph node (6.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for HDAC1 Gene



Protein tissue co-expression partners for HDAC1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of HDAC1 Gene:

HDAC1

SOURCE GeneReport for Unigene cluster for HDAC1 Gene:

Hs.88556

mRNA Expression by UniProt/SwissProt for HDAC1 Gene:

Q13547-HDAC1_HUMAN
Tissue specificity: Ubiquitous, with higher levels in heart, pancreas and testis, and lower levels in kidney and brain.

Evidence on tissue expression from TISSUES for HDAC1 Gene

  • Lung(4.8)
  • Stomach(4.7)
  • Blood(4.6)
  • Liver(4.5)
  • Intestine(4.2)
  • Nervous system(3.7)
  • Pancreas(2.8)
  • Kidney(2.7)
  • Heart(2.4)
  • Lymph node(2.4)
  • Muscle(2.4)
  • Skin(2.4)
  • Bone marrow(2.3)
  • Thyroid gland(2.3)
  • Eye(2.2)
genes like me logo Genes that share expression patterns with HDAC1: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HDAC1 Gene

Orthologs for HDAC1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for HDAC1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia HDAC1 33 32
  • 99.45 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Gm10093 33
  • 99 (a)
OneToMany
Hdac1 17 33 32
  • 90.46 (n)
oppossum
(Monodelphis domestica)
Mammalia -- 33
  • 96 (a)
OneToMany
-- 33
  • 62 (a)
OneToMany
dog
(Canis familiaris)
Mammalia HDAC1 33 32
  • 94.12 (n)
OneToOne
cow
(Bos Taurus)
Mammalia HDAC1 33 32
  • 93.91 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Hdac1 32
  • 90.94 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia HDAC1 33
  • 89 (a)
OneToOne
chicken
(Gallus gallus)
Aves HDAC1 33 32
  • 81.45 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia HDAC1 33
  • 92 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia hdac1 32
  • 79.18 (n)
Str.6529 32
zebrafish
(Danio rerio)
Actinopterygii hdac1 33
  • 90 (a)
OneToOne
-- 32
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP006511 32
  • 72.76 (n)
fruit fly
(Drosophila melanogaster)
Insecta Rpd3 33 34 32
  • 72.17 (n)
OneToMany
HDAC3 34
  • 57 (a)
worm
(Caenorhabditis elegans)
Secernentea hda-1 33 34
  • 64 (a)
ManyToMany
hda-3 33 32
  • 63.51 (n)
ManyToMany
hda-2 34
  • 51 (a)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AGR395W 32
  • 62.19 (n)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0E01981g 32
  • 61.15 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes RPD3 35 33 32
  • 60.28 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons HD1 32
  • 63.36 (n)
rice
(Oryza sativa)
Liliopsida Os06g0583400 32
  • 65.37 (n)
wheat
(Triticum aestivum)
Liliopsida Ta.23826 32
corn
(Zea mays)
Liliopsida Zm.13633 32
sea squirt
(Ciona savignyi)
Ascidiacea CSA.10476 33
  • 83 (a)
OneToMany
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes clr6 32
  • 63.16 (n)
bread mold
(Neurospora crassa)
Ascomycetes NCU00824 32
  • 62.75 (n)
Species where no ortholog for HDAC1 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for HDAC1 Gene

ENSEMBL:
Gene Tree for HDAC1 (if available)
TreeFam:
Gene Tree for HDAC1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for HDAC1: view image

Paralogs for HDAC1 Gene

(5) SIMAP similar genes for HDAC1 Gene using alignment to 6 proteins:

  • HDAC1_HUMAN
  • B5BU61_HUMAN
  • B5MGH2_HUMAN
  • F5GXM1_HUMAN
  • Q5TEE2_HUMAN
  • Q6IT96_HUMAN

Pseudogenes.org Pseudogenes for HDAC1 Gene

genes like me logo Genes that share paralogs with HDAC1: view

Variants for HDAC1 Gene

Sequence variations from dbSNP and Humsavar for HDAC1 Gene

SNP ID Clin Chr 01 pos Variation AA Info Type
rs797044931 likely-pathogenic, Inborn genetic diseases 32,327,044(+) A/G 5_prime_UTR_variant, coding_sequence_variant, missense_variant
rs1000005850 -- 32,315,064(+) T/C intron_variant
rs1000043838 -- 32,294,025(+) A/AA intron_variant
rs1000112357 -- 32,322,444(+) T/G intron_variant
rs1000164454 -- 32,308,468(+) A/T intron_variant

Structural Variations from Database of Genomic Variants (DGV) for HDAC1 Gene

Variant ID Type Subtype PubMed ID
nsv1122326 CNV deletion 24896259
nsv476322 CNV novel sequence insertion 20440878

Variation tolerance for HDAC1 Gene

Residual Variation Intolerance Score: 17.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.58; 65.16% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for HDAC1 Gene

Human Gene Mutation Database (HGMD)
HDAC1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
HDAC1

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HDAC1 Gene

Disorders for HDAC1 Gene

MalaCards: The human disease database

(11) MalaCards diseases for HDAC1 Gene - From: HGMD, DISEASES, Novoseek, and GeneCards