This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for ligands such as nitric oxide, oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variant... See more...

Aliases for GUCY1B1 Gene

Aliases for GUCY1B1 Gene

  • Guanylate Cyclase 1 Soluble Subunit Beta 1 2 3 5
  • Guanylate Cyclase Soluble Subunit Beta-1 3 4
  • Guanylate Cyclase Soluble Subunit Beta-3 3 4
  • Soluble Guanylate Cyclase Small Subunit 3 4
  • Guanylate Cyclase 1, Soluble, Beta 3 2 3
  • GCS-Beta-1 3 4
  • GCS-Beta-3 3 4
  • EC 4.6.1.2 4 52
  • GUCY1B3 3 4
  • GUC1B3 3 4
  • GUCSB3 3 4
  • Guanylate Cyclase 1 Soluble Subunit Beta 2
  • GC-S-Beta-1 3
  • GC-SB3 3
  • GUCB3 3

External Ids for GUCY1B1 Gene

Previous HGNC Symbols for GUCY1B1 Gene

  • GUC1B3
  • GUCY1B3

Summaries for GUCY1B1 Gene

Entrez Gene Summary for GUCY1B1 Gene

  • This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for ligands such as nitric oxide, oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

GeneCards Summary for GUCY1B1 Gene

GUCY1B1 (Guanylate Cyclase 1 Soluble Subunit Beta 1) is a Protein Coding gene. Diseases associated with GUCY1B1 include Bartter Syndrome, Type 2, Antenatal and Nemaline Myopathy 7. Among its related pathways are Oxytocin signaling pathway and Sweet Taste Signaling. An important paralog of this gene is GUCY1A2.

UniProtKB/Swiss-Prot Summary for GUCY1B1 Gene

  • Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP.

Gene Wiki entry for GUCY1B1 Gene

Additional gene information for GUCY1B1 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for GUCY1B1 Gene

Genomics for GUCY1B1 Gene

GeneHancer (GH) Regulatory Elements for GUCY1B1 Gene

Promoters and enhancers for GUCY1B1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH04J155757 Promoter/Enhancer 1.9 EPDnew Ensembl ENCODE CraniofacialAtlas 505.5 +0.5 522 3 ZBTB40 SP1 CTCF ZIC2 FOS ZBTB26 NFYB POLR2A ZNF341 HDAC2 GUCY1B1 LOC105377506 TDO2
GH04J155675 Enhancer 1 ENCODE dbSUPER 11.2 -82.7 -82656 1.5 EP300 ZSCAN5C ZNF639 ZIC2 ATF2 OSR2 BCL11A WT1 ZBTB17 TCF7L2 HSALNG0038022 GUCY1B1 GUCY1A1
GH04J155543 Enhancer 0.6 Ensembl ENCODE 15.4 -215.4 -215372 1.6 FOS GATA2 JUN POLR2A GUCY1B1 piR-50852-116 HSALNG0038031
GH04J155683 Enhancer 0.6 Ensembl dbSUPER 11.4 -73.6 -73572 1.6 USF1 PRDM6 FOXM1 CTBP1 ZNF680 PKNOX1 GUCY1B1 HSALNG0038022 GUCY1A1 lnc-ASIC5-2
GH04J155628 Enhancer 0.6 Ensembl ENCODE 10.7 -129.3 -129302 2.3 EP300 PRDM6 JUN IKZF1 GFI1B MLLT1 GUCY1B1 GUCY1A1 piR-61945-395 HSALNG0038032
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around GUCY1B1 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for GUCY1B1

Genomic Locations for GUCY1B1 Gene

Genomic Locations for GUCY1B1 Gene
chr4:155,758,973-155,807,774
(GRCh38/hg38)
Size:
48,802 bases
Orientation:
Plus strand
chr4:156,680,126-156,728,783
(GRCh37/hg19)
Size:
48,658 bases
Orientation:
Plus strand

Genomic View for GUCY1B1 Gene

Genes around GUCY1B1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
GUCY1B1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for GUCY1B1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for GUCY1B1 Gene

Proteins for GUCY1B1 Gene

  • Protein details for GUCY1B1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q02153-GCYB1_HUMAN
    Recommended name:
    Guanylate cyclase soluble subunit beta-1
    Protein Accession:
    Q02153
    Secondary Accessions:
    • B7Z426
    • Q86WY5

    Protein attributes for GUCY1B1 Gene

    Size:
    619 amino acids
    Molecular mass:
    70514 Da
    Cofactor:
    Name=heme; Xref=ChEBI:CHEBI:30413;
    Quaternary structure:
    • The active enzyme is formed by a heterodimer of an alpha and a beta subunit. Heterodimer with GUCY1A1 (PubMed:1352257, PubMed:23505436, PubMed:24669844). Can also form inactive homodimers in vitro (PubMed:23505436, PubMed:24669844).
    Miscellaneous:
    • There are two types of guanylate cyclases: soluble forms and membrane-associated receptor forms.

    Three dimensional structures from OCA and Proteopedia for GUCY1B1 Gene

    Alternative splice isoforms for GUCY1B1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for GUCY1B1 Gene

Selected DME Specific Peptides for GUCY1B1 Gene

Q02153:
  • GESVQIT
  • LKGQMIY
  • FHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEET
  • EECDHTQFLIEEKESKEEDFYEDLDRFEENGTQ
  • LLNDLYT
  • RGLYLSDIP
  • MPRYCLFG

Post-translational modifications for GUCY1B1 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for GUCY1B1 Gene

Gene Families for GUCY1B1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for GUCY1B1 Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ59711, highly similar to Guanylate cyclase soluble subunit beta-1 (EC 4.6.1.2) (B7Z426_HUMAN)
  • cDNA FLJ50853, highly similar to Guanylate cyclase soluble subunit beta-1 (EC 4.6.1.2) (B7Z685_HUMAN)
  • Soluble guanylate cyclase small subunit (GCYB1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q02153

UniProtKB/Swiss-Prot:

GCYB1_HUMAN :
  • Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
Family:
  • Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
genes like me logo Genes that share domains with GUCY1B1: view

Function for GUCY1B1 Gene

Molecular function for GUCY1B1 Gene

UniProtKB/Swiss-Prot Function:
Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=GTP = 3',5'-cyclic GMP + diphosphate; Xref=Rhea:RHEA:13665, ChEBI:CHEBI:33019, ChEBI:CHEBI:37565, ChEBI:CHEBI:57746; EC=4.6.1.2; Evidence=. ;.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by nitric oxide in the presence of magnesium or manganese ions.

Enzyme Numbers (IUBMB) for GUCY1B1 Gene

Phenotypes From GWAS Catalog for GUCY1B1 Gene

Gene Ontology (GO) - Molecular Function for GUCY1B1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004016 adenylate cyclase activity IEA --
GO:0004383 guanylate cyclase activity IDA,IEA 23505436
GO:0005515 protein binding IPI 23505436
GO:0005525 GTP binding IEA --
GO:0016829 lyase activity IEA --
genes like me logo Genes that share ontologies with GUCY1B1: view
genes like me logo Genes that share phenotypes with GUCY1B1: view

Animal Models for GUCY1B1 Gene

MGI Knock Outs for GUCY1B1:

Animal Model Products

CRISPR Products

miRNA for GUCY1B1 Gene

miRTarBase miRNAs that target GUCY1B1

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for GUCY1B1 Gene

Localization for GUCY1B1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for GUCY1B1 Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for GUCY1B1 gene
Compartment Confidence
cytosol 5
cytoskeleton 2
nucleus 2
plasma membrane 1
extracellular 1
mitochondrion 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for GUCY1B1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0008074 guanylate cyclase complex, soluble IDA 23505436
GO:0032991 protein-containing complex IEA --
GO:0048786 presynaptic active zone IBA 21873635
GO:0098831 presynaptic active zone cytoplasmic component IEA --
genes like me logo Genes that share ontologies with GUCY1B1: view

Pathways & Interactions for GUCY1B1 Gene

PathCards logo

SuperPathways for GUCY1B1 Gene

SuperPathway Contained pathways
1 G-Beta Gamma Signaling
.44
.37
.30
2 Oxytocin signaling pathway
3 Sweet Taste Signaling
.46
.37
4 cGMP-PKG signaling pathway
5 Circadian entrainment
genes like me logo Genes that share pathways with GUCY1B1: view

Pathways by source for GUCY1B1 Gene

3 GeneGo (Thomson Reuters) pathways for GUCY1B1 Gene
  • Apoptosis and survival_Anti-apoptotic action of nuclear ESR1 and ESR2
  • Development EDNRB signaling
  • NO-dependent CFTR activation (normal and CF)
10 Qiagen pathways for GUCY1B1 Gene
  • Cellular Effects of Sildenafil
  • CRHR Pathway
  • Dopamine-DARPP32 Feedback onto cAMP Pathway
  • eNOS Signaling
  • Intracellular Calcium Signaling

Gene Ontology (GO) - Biological Process for GUCY1B1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006182 cGMP biosynthetic process IDA,IEA 23505436
GO:0007263 nitric oxide mediated signal transduction TAS 9742212
GO:0008015 blood circulation TAS 9742212
GO:0009190 cyclic nucleotide biosynthetic process IEA --
GO:0019934 cGMP-mediated signaling IBA 21873635
genes like me logo Genes that share ontologies with GUCY1B1: view

No data available for SIGNOR curated interactions for GUCY1B1 Gene

Drugs & Compounds for GUCY1B1 Gene

(15) Drugs for GUCY1B1 Gene - From: ApexBio, DGIdb, HMDB, and Tocris

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Riociguat Approved Pharma Soluble guanylate cyclase (sGC) stimulator 48
Magnesium Approved, Experimental, Investigational Pharma 0
Phosphoric acid Approved Pharma 0
Manganese Approved Nutra 51
Cyclic GMP Experimental Pharma 0

(1) Additional Compounds for GUCY1B1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • [(ho)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • PYROphosphATE
14000-31-8

(5) Tocris Compounds for GUCY1B1 Gene

Compound Action Cas Number
A 350619 hydrochloride Soluble guanylyl cyclase (sGC) activator 1217201-17-6
BAY 41-2272 Soluble guanylyl cyclase (sGC) activator 256376-24-6
BPIPP Non-competitive GC inhibitor. Also AC inhibitor 325746-94-9
CFM 1571 hydrochloride Soluble guanylyl cyclase (sGC) activator 1215548-30-3
YC 1 Soluble guanylyl cyclase (sGC) activator; induces G1 cell cycle arrest 170632-47-0

(8) ApexBio Compounds for GUCY1B1 Gene

Compound Action Cas Number
A 350619 hydrochloride Activator of soluble guanylyl cyclase (sGC) 1217201-17-6
BAY 41-2272 Activator of soluble guanylyl cyclase (sGC) 256376-24-6
BPIPP 325746-94-9
CFM 1571 hydrochloride sGC activator 1215548-30-3
Cinaciguat Soluble guanylate cyclase (sGC) activators 329773-35-5
Guanylin (human) 183200-12-6
NS 2028 204326-43-2
Riociguat Soluble guanylate cyclase (sGC) stimulator 625115-55-1
genes like me logo Genes that share compounds with GUCY1B1: view

Drug Products

Transcripts for GUCY1B1 Gene

mRNA/cDNA for GUCY1B1 Gene

6 REFSEQ mRNAs :
17 NCBI additional mRNA sequence :
8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for GUCY1B1 Gene

No ASD Table

Relevant External Links for GUCY1B1 Gene

GeneLoc Exon Structure for
GUCY1B1

Expression for GUCY1B1 Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for GUCY1B1

mRNA Expression by UniProt/SwissProt for GUCY1B1 Gene:

Q02153-GCYB1_HUMAN
Tissue specificity: Detected in brain cortex and cerebellum (at protein level).

Evidence on tissue expression from TISSUES for GUCY1B1 Gene

  • Nervous system(4.9)
  • Kidney(4.4)
  • Lung(4.4)
  • Eye(2.1)

No data available for mRNA expression in normal human tissues , mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues , Protein expression , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for GUCY1B1 Gene

Orthologs for GUCY1B1 Gene

This gene was present in the common ancestor of animals.

Orthologs for GUCY1B1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia GUCY1B3 31 30
  • 99.78 (n)
OneToOne
cow
(Bos Taurus)
Mammalia GUCY1B1 31
  • 99 (a)
OneToOne
GUCY1B3 30
  • 90.41 (n)
oppossum
(Monodelphis domestica)
Mammalia GUCY1B3 31
  • 98 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia GUCY1B3 31
  • 97 (a)
OneToOne
dog
(Canis familiaris)
Mammalia GUCY1B3 31 30
  • 92.84 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Gucy1b3 31 30
  • 88.69 (n)
OneToOne
Gucy1b1 17
rat
(Rattus norvegicus)
Mammalia Gucy1b3 30
  • 88.42 (n)
chicken
(Gallus gallus)
Aves GUCY1B3 31 30
  • 83.98 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia GUCY1B3 31
  • 97 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia gucy1b3 30
  • 80.53 (n)
zebrafish
(Danio rerio)
Actinopterygii gucy1b3 31 30
  • 77.21 (n)
OneToOne
fruit fly
(Drosophila melanogaster)
Insecta Gycbeta100B 31 30
  • 58.57 (n)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP000214 30
  • 57.91 (n)
worm
(Caenorhabditis elegans)
Secernentea gcy-34 30
  • 48.04 (n)
gcy-31 31
  • 27 (a)
OneToMany
gcy-37 31
  • 25 (a)
OneToMany
gcy-33 31
  • 18 (a)
OneToMany
acy-3 31
  • 9 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 51 (a)
OneToOne
Cin.13250 30
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.13250 30
Species where no ortholog for GUCY1B1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for GUCY1B1 Gene

ENSEMBL:
Gene Tree for GUCY1B1 (if available)
TreeFam:
Gene Tree for GUCY1B1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for GUCY1B1: view image

Paralogs for GUCY1B1 Gene

Pseudogenes.org Pseudogenes for GUCY1B1 Gene

genes like me logo Genes that share paralogs with GUCY1B1: view

Variants for GUCY1B1 Gene

Additional dbSNP identifiers (rs#s) for GUCY1B1 Gene

Structural Variations from Database of Genomic Variants (DGV) for GUCY1B1 Gene

Variant ID Type Subtype PubMed ID
nsv1029122 CNV gain 25217958
nsv521382 CNV loss 19592680
nsv818286 CNV gain 17921354

Variation tolerance for GUCY1B1 Gene

Residual Variation Intolerance Score: 17% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.21; 24.39% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for GUCY1B1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
GUCY1B1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for GUCY1B1 Gene

Disorders for GUCY1B1 Gene

MalaCards: The human disease database

(4) MalaCards diseases for GUCY1B1 Gene - From: DISEASES

Disorder Aliases PubMed IDs
bartter syndrome, type 2, antenatal
  • abs2
nemaline myopathy 7
  • nem7
moyamoya disease 1
  • mymy1
cone-rod dystrophy 6
  • retinitis pigmentosa 6
- elite association - COSMIC cancer census association via MalaCards

Additional Disease Information for GUCY1B1

genes like me logo Genes that share disorders with GUCY1B1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for GUCY1B1 Gene

Publications for GUCY1B1 Gene

  1. Molecular cloning of the cDNAs coding for the two subunits of soluble guanylyl cyclase from human brain. (PMID: 1352257) Giuili G … Guellaën G (FEBS letters 1992) 2 3 4 54
  2. Crystal structures of the catalytic domain of human soluble guanylate cyclase. (PMID: 23505436) Allerston CK … Gileadi O (PloS one 2013) 3 4 54
  3. Soluble guanylate cyclase beta1-subunit expression is increased in mononuclear cells from patients with erectile dysfunction. (PMID: 16528291) Mateos-Cáceres PJ … López-Farré AJ (International journal of impotence research 2006) 3 23 54
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 54
  5. Heterogeneity in human soluble guanylate cyclase due to alternative splicing. (PMID: 1680753) Chhajlani V … Wikberg JE (FEBS letters 1991) 3 4 54

Products for GUCY1B1 Gene

Sources for GUCY1B1 Gene