This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal, mitochondrial, and transcription factor proteins. Data from rodent models supports a role for this gene in embryonic develo... See more...

Aliases for GRK2 Gene

Aliases for GRK2 Gene

  • G Protein-Coupled Receptor Kinase 2 2 3 5
  • Beta-Adrenergic Receptor Kinase 1 3 4
  • EC 2.7.11.15 4 52
  • Beta-ARK-1 3 4
  • ADRBK1 3 4
  • BARK1 3 4
  • G-Protein Coupled Receptor Kinase 2 4
  • Adrenergic, Beta, Receptor Kinase 1 2
  • Adrenergic Beta Receptor Kinase 1 3
  • BETA-ARK1 3
  • EC 2.7.11 52
  • BARK 4

External Ids for GRK2 Gene

Previous HGNC Symbols for GRK2 Gene

  • ADRBK1

Summaries for GRK2 Gene

Entrez Gene Summary for GRK2 Gene

  • This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal, mitochondrial, and transcription factor proteins. Data from rodent models supports a role for this gene in embryonic development, heart function and metabolism. Elevated expression of this gene has been observed in human patients with heart failure and Alzheimer's disease. [provided by RefSeq, Sep 2017]

GeneCards Summary for GRK2 Gene

GRK2 (G Protein-Coupled Receptor Kinase 2) is a Protein Coding gene. Diseases associated with GRK2 include Heart Disease and Alzheimer Disease. Among its related pathways are Signaling by GPCR and CCR5 Pathway in Macrophages. An important paralog of this gene is GRK3.

UniProtKB/Swiss-Prot Summary for GRK2 Gene

  • Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner (PubMed:19306925, PubMed:19715378). Positively regulates ciliary smoothened (SMO)-dependent Hedgehog (Hh) signaling pathway by facilitating the trafficking of SMO into the cilium and the stimulation of SMO activity (By similarity).

Gene Wiki entry for GRK2 Gene

Additional gene information for GRK2 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for GRK2 Gene

Genomics for GRK2 Gene

GeneHancer (GH) Regulatory Elements for GRK2 Gene

Promoters and enhancers for GRK2 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH11J067265 Promoter/Enhancer 2.7 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 513.7 +12.1 12064 25.5 RXRA ZBTB40 ZNF217 EP300 CTCF SIN3A NRF1 POLR2G USF1 SP1 GRK2 ANKRD13D KDM2A RBM4 KMT5B RAD9A SSH3 RCE1 ENSG00000245156 PTPRCAP
GH11J067264 Enhancer 0.5 FANTOM5 dbSUPER 500.7 -1.4 -1363 0.1 FOS GRK2 piR-40653
GH11J067316 Promoter/Enhancer 1.7 Ensembl ENCODE CraniofacialAtlas 12.8 +51.4 51401 2.8 ZBTB40 ZNF217 EP300 CTCF SIN3A NRF1 POLR2G SP1 GTF2E2 SIX5 ENSG00000287851 LOC100130987 RAD9A TBC1D10C GRK2 UNC93B1 SSH3 POLD4 RN7SKP239 CLCF1
GH11J066965 Promoter/Enhancer 1.9 FANTOM5 Ensembl ENCODE dbSUPER 2.6 -297.4 -297378 6.8 EP300 FOXK2 TCF12 POLR2G NCOR1 JUND FOS ZNF639 REST KDM6A lnc-C11orf86-2 CLCF1 RAD9A PC RNU7-23P CTSF SPTBN2 GRK2 KDM2A POLD4
GH11J067077 Enhancer 1.2 FANTOM5 ENCODE dbSUPER 3.7 -188.1 -188075 2.5 ZNF217 POLR2A KLF4 RELA EP300 CTBP1 GATAD2B ESRRA DEK MYC RF00017-952 RHOD KDM2A ANKRD13D CDK2AP2 GRK2 RBM4 CLCF1 SSH3 TMEM134
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around GRK2 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for GRK2

Genomic Locations for GRK2 Gene

Genomic Locations for GRK2 Gene
chr11:67,266,400-67,286,558
(GRCh38/hg38)
Size:
20,159 bases
Orientation:
Plus strand
chr11:67,033,881-67,054,029
(GRCh37/hg19)
Size:
20,149 bases
Orientation:
Plus strand

Genomic View for GRK2 Gene

Genes around GRK2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
GRK2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for GRK2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for GRK2 Gene

Proteins for GRK2 Gene

  • Protein details for GRK2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P25098-ARBK1_HUMAN
    Recommended name:
    Beta-adrenergic receptor kinase 1
    Protein Accession:
    P25098
    Secondary Accessions:
    • B0ZBE1
    • Q13837
    • Q6GTT3

    Protein attributes for GRK2 Gene

    Size:
    689 amino acids
    Molecular mass:
    79574 Da
    Quaternary structure:
    • Interacts with GIT1 (By similarity). Interacts with, and phosphorylates chemokine-stimulated CCR5 (PubMed:10085131). Interacts with ARRB1 (PubMed:9501202). Interacts with LPAR1 and LPAR2 (PubMed:19306925). Interacts with RALA in response to LPAR1 activation (PubMed:19306925). ADRBK1 and RALA mutually inhibit each other's binding to LPAR1 (PubMed:19306925). Interacts with ADRB2 (PubMed:19715378).

    Three dimensional structures from OCA and Proteopedia for GRK2 Gene

neXtProt entry for GRK2 Gene

Selected DME Specific Peptides for GRK2 Gene

P25098:
  • QRVPKMKNKPRSPVVELSK
  • CSHPFSK
  • SVEETQIK
  • ISERWQQEVAETV
  • KFTRFCQWKNVELNIHL
  • YAFHTPDKL
  • YDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDR
  • DVFQKFIES
  • EI