This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal, mitochondrial, and transcription factor proteins. Data from rodent models supports a role for this gene in embryonic develo... See more...

Aliases for GRK2 Gene

Aliases for GRK2 Gene

  • G Protein-Coupled Receptor Kinase 2 2 3 5
  • Beta-Adrenergic Receptor Kinase 1 3 4
  • EC 2.7.11.15 4 52
  • Beta-ARK-1 3 4
  • ADRBK1 3 4
  • BARK1 3 4
  • G-Protein Coupled Receptor Kinase 2 4
  • Adrenergic, Beta, Receptor Kinase 1 2
  • Adrenergic Beta Receptor Kinase 1 3
  • BETA-ARK1 3
  • EC 2.7.11 52
  • BARK 4

External Ids for GRK2 Gene

Previous HGNC Symbols for GRK2 Gene

  • ADRBK1

Summaries for GRK2 Gene

Entrez Gene Summary for GRK2 Gene

  • This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal, mitochondrial, and transcription factor proteins. Data from rodent models supports a role for this gene in embryonic development, heart function and metabolism. Elevated expression of this gene has been observed in human patients with heart failure and Alzheimer's disease. [provided by RefSeq, Sep 2017]

GeneCards Summary for GRK2 Gene

GRK2 (G Protein-Coupled Receptor Kinase 2) is a Protein Coding gene. Diseases associated with GRK2 include Heart Disease and Alzheimer Disease. Among its related pathways are Signaling by GPCR and CCR5 Pathway in Macrophages. An important paralog of this gene is GRK3.

UniProtKB/Swiss-Prot Summary for GRK2 Gene

  • Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner (PubMed:19306925, PubMed:19715378). Positively regulates ciliary smoothened (SMO)-dependent Hedgehog (Hh) signaling pathway by facilitating the trafficking of SMO into the cilium and the stimulation of SMO activity (By similarity).

Gene Wiki entry for GRK2 Gene

Additional gene information for GRK2 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for GRK2 Gene

Genomics for GRK2 Gene

GeneHancer (GH) Regulatory Elements for GRK2 Gene

Promoters and enhancers for GRK2 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH11J067265 Promoter/Enhancer 2.7 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 513.7 +12.1 12064 25.5 RXRA ZBTB40 ZNF217 EP300 CTCF SIN3A NRF1 POLR2G USF1 SP1 GRK2 ANKRD13D KDM2A RBM4 KMT5B RAD9A SSH3 RCE1 ENSG00000245156 PTPRCAP
GH11J067264 Enhancer 0.5 FANTOM5 dbSUPER 500.7 -1.4 -1363 0.1 FOS GRK2 piR-40653
GH11J067316 Promoter/Enhancer 1.7 Ensembl ENCODE CraniofacialAtlas 12.8 +51.4 51401 2.8 ZBTB40 ZNF217 EP300 CTCF SIN3A NRF1 POLR2G SP1 GTF2E2 SIX5 ENSG00000287851 LOC100130987 RAD9A TBC1D10C GRK2 UNC93B1 SSH3 POLD4 RN7SKP239 CLCF1
GH11J066965 Promoter/Enhancer 1.9 FANTOM5 Ensembl ENCODE dbSUPER 2.6 -297.4 -297378 6.8 EP300 FOXK2 TCF12 POLR2G NCOR1 JUND FOS ZNF639 REST KDM6A lnc-C11orf86-2 CLCF1 RAD9A PC RNU7-23P CTSF SPTBN2 GRK2 KDM2A POLD4
GH11J067077 Enhancer 1.2 FANTOM5 ENCODE dbSUPER 3.7 -188.1 -188075 2.5 ZNF217 POLR2A KLF4 RELA EP300 CTBP1 GATAD2B ESRRA DEK MYC RF00017-952 RHOD KDM2A ANKRD13D CDK2AP2 GRK2 RBM4 CLCF1 SSH3 TMEM134
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around GRK2 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for GRK2

Genomic Locations for GRK2 Gene

Genomic Locations for GRK2 Gene
chr11:67,266,400-67,286,558
(GRCh38/hg38)
Size:
20,159 bases
Orientation:
Plus strand
chr11:67,033,881-67,054,029
(GRCh37/hg19)
Size:
20,149 bases
Orientation:
Plus strand

Genomic View for GRK2 Gene

Genes around GRK2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
GRK2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for GRK2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for GRK2 Gene

Proteins for GRK2 Gene

  • Protein details for GRK2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P25098-ARBK1_HUMAN
    Recommended name:
    Beta-adrenergic receptor kinase 1
    Protein Accession:
    P25098
    Secondary Accessions:
    • B0ZBE1
    • Q13837
    • Q6GTT3

    Protein attributes for GRK2 Gene

    Size:
    689 amino acids
    Molecular mass:
    79574 Da
    Quaternary structure:
    • Interacts with GIT1 (By similarity). Interacts with, and phosphorylates chemokine-stimulated CCR5 (PubMed:10085131). Interacts with ARRB1 (PubMed:9501202). Interacts with LPAR1 and LPAR2 (PubMed:19306925). Interacts with RALA in response to LPAR1 activation (PubMed:19306925). ADRBK1 and RALA mutually inhibit each other's binding to LPAR1 (PubMed:19306925). Interacts with ADRB2 (PubMed:19715378).

    Three dimensional structures from OCA and Proteopedia for GRK2 Gene

neXtProt entry for GRK2 Gene

Selected DME Specific Peptides for GRK2 Gene

P25098:
  • QRVPKMKNKPRSPVVELSK
  • CSHPFSK
  • SVEETQIK
  • ISERWQQEVAETV
  • KFTRFCQWKNVELNIHL
  • YAFHTPDKL
  • YDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDR
  • DVFQKFIES
  • EIKKYEKL
  • VVYRDLK
  • GKDCIMHGYM
  • LGCLGRGAQEVKE
  • FFRSLDW
  • PPRGEVNAADAFDIGSFDEEDTKGIKL
  • EARKKAKNKQL
  • SADWFSLG
  • LPEPSIRSVMQ
  • RISDLGLACDFSKKKPHASVGTHGYMAPEVLQKG
  • GNPFLTQWQRRYFYLFPNRLEWRGE
  • FSPELRSLLEGLLQRDV
  • EIILGLEHMHNRFVVYRDLKPANILLDEHGH
  • GHSPFRQHK
  • LSFILDLMNGGDLHYHLSQHGVFSEADMR
  • QSLLTME
  • DCPFIVCM
  • YMAPEVL
  • LTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCL
  • LFQPYIEEIC
  • LQCDSDPELVQWKKELRD
  • RISDLGLA
  • FILDLMNGGD
  • ILGLEHMH

Post-translational modifications for GRK2 Gene

  • Ubiquitination at Lys57, Lys62, Lys164, Lys448, Lys644, and Lys677
  • Modification sites at PhosphoSitePlus

Other Protein References for GRK2 Gene

Domains & Families for GRK2 Gene

Gene Families for GRK2 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for GRK2 Gene

Blocks:
  • Pleckstrin-like
  • Protein kinase C-terminal domain
  • Regulator of G-protein signalling (RGS) protein signature
  • GPCR kinase signature
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for GRK2 Gene

GenScript: Design optimal peptide antigens:
  • G-protein coupled receptor kinase 2 (ARBK1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P25098

UniProtKB/Swiss-Prot:

ARBK1_HUMAN :
  • The PH domain binds anionic phospholipids and helps recruiting ADRBK1 from the cytoplasm to plasma membrane close to activated receptors. It mediates binding to G protein beta and gamma subunits, competing with G-alpha subunits and other G-betagamma effectors.
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily.
Domain:
  • The PH domain binds anionic phospholipids and helps recruiting ADRBK1 from the cytoplasm to plasma membrane close to activated receptors. It mediates binding to G protein beta and gamma subunits, competing with G-alpha subunits and other G-betagamma effectors.
Family:
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily.
genes like me logo Genes that share domains with GRK2: view

Function for GRK2 Gene

Molecular function for GRK2 Gene

UniProtKB/Swiss-Prot Function:
Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner (PubMed:19306925, PubMed:19715378). Positively regulates ciliary smoothened (SMO)-dependent Hedgehog (Hh) signaling pathway by facilitating the trafficking of SMO into the cilium and the stimulation of SMO activity (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=[beta-adrenergic receptor] + ATP = [beta-adrenergic receptor]-phosphate + ADP + H(+); Xref=Rhea:RHEA:19429, Rhea:RHEA-COMP:11222, Rhea:RHEA-COMP:11223, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43176, ChEBI:CHEBI:68546, ChEBI:CHEBI:456216; EC=2.7.11.15; Evidence=. ;.
UniProtKB/Swiss-Prot EnzymeRegulation:
In contrast to other AGC family kinases, the catalytic activity is solely regulated by the binding of substrates and ligands, not by phosphorylation of the kinase domain.

Enzyme Numbers (IUBMB) for GRK2 Gene

Phenotypes From GWAS Catalog for GRK2 Gene

Gene Ontology (GO) - Molecular Function for GRK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA,ISS --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0004703 G protein-coupled receptor kinase activity IEA,ISS --
GO:0005515 protein binding IPI 17006543
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with GRK2: view
genes like me logo Genes that share phenotypes with GRK2: view

Animal Models for GRK2 Gene

MGI Knock Outs for GRK2:

Animal Model Products

CRISPR Products

miRNA for GRK2 Gene

miRTarBase miRNAs that target GRK2

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GRK2

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for GRK2 Gene

Localization for GRK2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for GRK2 Gene

Cytoplasm. Cell membrane.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for GRK2 gene
Compartment Confidence
plasma membrane 5
cytosol 5
nucleus 3
extracellular 2
cytoskeleton 2
mitochondrion 2
endoplasmic reticulum 2
endosome 2
lysosome 2
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for GRK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA,IDA 17986524
GO:0005829 cytosol TAS --
GO:0005886 plasma membrane TAS --
GO:0005929 cilium TAS --
GO:0016020 membrane ISS --
genes like me logo Genes that share ontologies with GRK2: view

Pathways & Interactions for GRK2 Gene

genes like me logo Genes that share pathways with GRK2: view

Pathways by source for GRK2 Gene

2 GeneGo (Thomson Reuters) pathways for GRK2 Gene
  • Development Angiotensin signaling via beta-Arrestin
  • G-protein signaling G-Protein alpha-q signaling cascades
3 Qiagen pathways for GRK2 Gene
  • Chemokine Signaling
  • Colorectal Cancer Metastasis
  • G-AlphaQ Signaling
1 Cell Signaling Technology pathway for GRK2 Gene

SIGNOR curated interactions for GRK2 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:
Other effect:

Gene Ontology (GO) - Biological Process for GRK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002026 regulation of the force of heart contraction IEA --
GO:0002029 desensitization of G protein-coupled receptor signaling pathway ISS --
GO:0003108 negative regulation of the force of heart contraction by chemical signal IMP 15051637
GO:0006468 protein phosphorylation IEA --
GO:0007165 signal transduction IEA --
genes like me logo Genes that share ontologies with GRK2: view

Drugs & Compounds for GRK2 Gene

(28) Drugs for GRK2 Gene - From: DrugBank, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Zinc Approved, Investigational Pharma 2822
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation, Target 0

(26) Additional Compounds for GRK2 Gene - From: Novoseek, HMDB, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor 58-64-0
[D-Trp7,9,10]-Substance P
89430-38-6
G-Protein antagonist peptide
143675-79-0
Gue 1654
397290-30-1
mastoparan
72093-21-1

(5) Tocris Compounds for GRK2 Gene

Compound Action Cas Number
[D-Trp7,9,10]-Substance P Inhibits M1 ACh receptor activation of Gq/11 89430-38-6
G-Protein antagonist peptide Inhibits G protein activation by GPCRs 143675-79-0
Gue 1654 Selective inhibitor of OXE-R Gbetagamma signaling 397290-30-1
Mastoparan Activates Gi and Go 72093-21-1
SCH 202676 hydrobromide Inhibitor of ligand binding to G-protein-coupled receptors 265980-25-4
genes like me logo Genes that share compounds with GRK2: view

Transcripts for GRK2 Gene

mRNA/cDNA for GRK2 Gene

1 REFSEQ mRNAs :
10 NCBI additional mRNA sequence :
14 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GRK2

Alternative Splicing Database (ASD) splice patterns (SP) for GRK2 Gene

No ASD Table

Relevant External Links for GRK2 Gene

GeneLoc Exon Structure for
GRK2

Expression for GRK2 Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for GRK2

mRNA Expression by UniProt/SwissProt for GRK2 Gene:

P25098-ARBK1_HUMAN
Tissue specificity: Expressed in peripheral blood leukocytes.

Evidence on tissue expression from TISSUES for GRK2 Gene

  • Blood(4.7)
  • Nervous system(4.7)
  • Heart(3)
  • Muscle(2.9)
  • Intestine(2.8)
  • Lung(2.7)
  • Kidney(2.6)
  • Bone marrow(2.2)
  • Adrenal gland(2.1)
  • Lymph node(2)

No data available for mRNA expression in normal human tissues , mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues , Protein expression , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for GRK2 Gene

Orthologs for GRK2 Gene

This gene was present in the common ancestor of animals.

Orthologs for GRK2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ADRBK1 31 30
  • 99.61 (n)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia ADRBK1 31
  • 95 (a)
OneToOne
cow
(Bos Taurus)
Mammalia ADRBK1 31 30
  • 93.03 (n)
OneToOne
dog
(Canis familiaris)
Mammalia ADRBK1 31 30
  • 92.74 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Adrbk1 30
  • 90.32 (n)
mouse
(Mus musculus)
Mammalia Adrbk1 31 30
  • 89.85 (n)
OneToOne
Grk2 17
chicken
(Gallus gallus)
Aves ADRBK1 31 30
  • 85.42 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia ADRBK1 31
  • 92 (a)
OneToOne
zebrafish
(Danio rerio)
Actinopterygii adrbk2 31
  • 85 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta Gprk1 31
  • 65 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea grk-2 31
  • 64 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.9837 31
  • 59 (a)
ManyToMany
Species where no ortholog for GRK2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • oppossum (Monodelphis domestica)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)

Evolution for GRK2 Gene

ENSEMBL:
Gene Tree for GRK2 (if available)
TreeFam:
Gene Tree for GRK2 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for GRK2: view image

Paralogs for GRK2 Gene

Paralogs for GRK2 Gene

genes like me logo Genes that share paralogs with GRK2: view

Variants for GRK2 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for GRK2 Gene

SNP ID Clinical significance and condition Chr 11 pos Variation AA Info Type
720057 Benign: not provided 67,284,851(+) C/T SYNONYMOUS_VARIANT
744642 Likely Benign: not provided 67,282,535(+) C/T SYNONYMOUS_VARIANT
764908 Likely Benign: not provided 67,284,206(+) T/A INTRON_VARIANT
776631 Benign: not provided 67,285,449(+) G/A SYNONYMOUS_VARIANT
VAR_040379 A colorectal adenocarcinoma sample p.Arg578Gln

Additional dbSNP identifiers (rs#s) for GRK2 Gene

Structural Variations from Database of Genomic Variants (DGV) for GRK2 Gene

Variant ID Type Subtype PubMed ID
nsv1118215 CNV deletion 24896259
nsv468603 CNV loss 19166990
nsv555253 CNV loss 21841781
nsv951021 CNV deletion 24416366

Variation tolerance for GRK2 Gene

Residual Variation Intolerance Score: 2.58% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.06; 21.66% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for GRK2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
GRK2

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GRK2 Gene

Disorders for GRK2 Gene

MalaCards: The human disease database

(4) MalaCards diseases for GRK2 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
heart disease
  • congenital heart disease
alzheimer disease
  • ad
hypertension, essential
  • eht
myocardial infarction
  • myocardial infarction, susceptibility to
- elite association - COSMIC cancer census association via MalaCards
Search GRK2 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for GRK2

genes like me logo Genes that share disorders with GRK2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for GRK2 Gene

Publications for GRK2 Gene

  1. Monocyte chemoattractant protein-1-induced CCR2B receptor desensitization mediated by the G protein-coupled receptor kinase 2. (PMID: 9501202) Aragay AM … Mayor F (Proceedings of the National Academy of Sciences of the United States of America 1998) 3 4 23 54
  2. cDNA cloning and chromosomal localization of the human beta-adrenergic receptor kinase. (PMID: 2037065) Benovic JL … Lefkowitz RJ (FEBS letters 1991) 2 3 4 54
  3. Dynamic changes in lymphocyte GRK2 levels in cardiac transplant patients: a biomarker for left ventricular function. (PMID: 20443948) Bonita RE … Koch WJ (Clinical and translational science 2010) 3 23 54
  4. [High glucose up-regulates GRK2 gene expression in H9C2 cardiomyoblasts in vitro]. (PMID: 20335112) Chen HM … Yu XY (Nan fang yi ke da xue xue bao = Journal of Southern Medical University 2010) 3 23 54
  5. G protein-coupled receptor kinase 2 (GRK2) modulation and cell cycle progression. (PMID: 20080565) Penela P … Mayor F (Proceedings of the National Academy of Sciences of the United States of America 2010) 3 23 54

Products for GRK2 Gene

  • Addgene plasmids for GRK2

Sources for GRK2 Gene