This gene encodes a mitochondrial enzyme which prefers saturated fatty acids as its substrate for the synthesis of glycerolipids. This metabolic pathway's first step is catalyzed by the encoded enzyme. Two forms for this enzyme exist, one in the mitochondria and one in the endoplasmic reticulum. Two alternatively spliced transcript variants have been described for this gene. [p... See more...

Aliases for GPAM Gene

Aliases for GPAM Gene

  • Glycerol-3-Phosphate Acyltransferase, Mitochondrial 2 3 5
  • Glycerol-3-Phosphate Acyltransferase 1, Mitochondrial 2 3 4
  • EC 2.3.1.15 4 52
  • GPAT-1 3 4
  • GPAT1 3 4
  • KIAA1560 4
  • EC 2.3.1 52
  • GPAT 3

External Ids for GPAM Gene

Previous GeneCards Identifiers for GPAM Gene

  • GC10U990097
  • GC10M113575
  • GC10M113899
  • GC10M107537

Summaries for GPAM Gene

Entrez Gene Summary for GPAM Gene

  • This gene encodes a mitochondrial enzyme which prefers saturated fatty acids as its substrate for the synthesis of glycerolipids. This metabolic pathway's first step is catalyzed by the encoded enzyme. Two forms for this enzyme exist, one in the mitochondria and one in the endoplasmic reticulum. Two alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2011]

GeneCards Summary for GPAM Gene

GPAM (Glycerol-3-Phosphate Acyltransferase, Mitochondrial) is a Protein Coding gene. Diseases associated with GPAM include Body Mass Index Quantitative Trait Locus 11 and Diabetes Mellitus, Noninsulin-Dependent. Among its related pathways are Estrogen Receptor Pathway and Regulation of cholesterol biosynthesis by SREBP (SREBF). Gene Ontology (GO) annotations related to this gene include transferase activity, transferring acyl groups and glycerol-3-phosphate O-acyltransferase activity. An important paralog of this gene is GPAT2.

UniProtKB/Swiss-Prot Summary for GPAM Gene

  • Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.

Gene Wiki entry for GPAM Gene

Additional gene information for GPAM Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for GPAM Gene

Genomics for GPAM Gene

GeneHancer (GH) Regulatory Elements for GPAM Gene

Promoters and enhancers for GPAM Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH10J112182 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 500.3 +31.6 31630 2.7 ZBTB40 ZNF217 EP300 SIN3A TCF12 MYC SP1 PHF8 FOS ZFX GPAM TECTB piR-61532-045 lnc-GPAM-1 HSALNG0080673
GH10J112214 Promoter/Enhancer 1.4 EPDnew Ensembl ENCODE dbSUPER 500.7 +0.8 794 3.2 POLR2G MXI1 FOXA2 NR2F2 GATA3 ZBTB33 RBM22 USF1 JUND BATF GPAM lnc-GPAM-1 piR-61532-045
GH10J112227 Promoter/Enhancer 1.2 EPDnew dbSUPER 500.4 -12.3 -12302 0.1 EP300 FOXK2 NCOR1 KDM6A TCF7 FOXA1 ZBTB7A SKI TEAD1 ZBTB26 LOC101927600 lnc-GPAM-2 GPAM TECTB
GH10J112218 Promoter/Enhancer 1 EPDnew Ensembl dbSUPER 500.7 -2.6 -2606 0.8 ZSCAN5C ATF2 OSR2 CREB1 ZBTB21 JUN ATF7 GPAM LOC101927600 lnc-GPAM-2
GH10J112222 Enhancer 1 ENCODE dbSUPER 8.4 -8.8 -8822 3.1 NCOR1 TCF7 RBM25 FOXA2 SIN3A NR2F2 SAP130 ZBTB33 HDAC1 JUND GPAM TECTB LOC101927600 lnc-GPAM-2
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around GPAM on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for GPAM

Top Transcription factor binding sites by QIAGEN in the GPAM gene promoter:
  • c-Myc
  • FOXO3
  • GATA-2
  • HNF-3beta
  • LCR-F1
  • Max1
  • Pax-2
  • Pax-2a
  • Pax-2b
  • ZIC2

Genomic Locations for GPAM Gene

Genomic Locations for GPAM Gene
chr10:112,149,864-112,215,395
(GRCh38/hg38)
Size:
65,532 bases
Orientation:
Minus strand
chr10:113,909,622-113,975,135
(GRCh37/hg19)
Size:
65,514 bases
Orientation:
Minus strand

Genomic View for GPAM Gene

Genes around GPAM on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
GPAM Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for GPAM Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for GPAM Gene

Proteins for GPAM Gene

  • Protein details for GPAM Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9HCL2-GPAT1_HUMAN
    Recommended name:
    Glycerol-3-phosphate acyltransferase 1, mitochondrial
    Protein Accession:
    Q9HCL2
    Secondary Accessions:
    • Q5VW51
    • Q86TA3

    Protein attributes for GPAM Gene

    Size:
    828 amino acids
    Molecular mass:
    93795 Da
    Quaternary structure:
    No Data Available

neXtProt entry for GPAM Gene

Selected DME Specific Peptides for GPAM Gene

Q9HCL2:
  • KAASLCYLLSNEGTISLPCQTFYQ
  • VAVYAESATYCLVKNAVK
  • RPFVGRCC
  • TLVEDFFVMKEEVLARDFDLGFSGNSEDVVMHAIQ
  • HRSHIDY
  • GISYDRIIEGHYNGEQLGKPKKNESLWS
  • GTIDVSYLP
  • FLEGTRSR
  • LAEHILFTASKSCAIMSTHIVACLLLYRHRQGI

Post-translational modifications for GPAM Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for GPAM Gene

Domains & Families for GPAM Gene

Gene Families for GPAM Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted membrane proteins

Protein Domains for GPAM Gene

Blocks:
  • Phospholipid/glycerol acyltransferase
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for GPAM Gene

GenScript: Design optimal peptide antigens:
  • Glycerol-3-phosphate acyltransferase 1, mitochondrial (GPAT1_HUMAN)
  • Glycerol-3-phosphate acyltransferase, mitochondrial (Q8N1G6_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9HCL2

UniProtKB/Swiss-Prot:

GPAT1_HUMAN :
  • The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
  • Belongs to the GPAT/DAPAT family.
Domain:
  • The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
Family:
  • Belongs to the GPAT/DAPAT family.
genes like me logo Genes that share domains with GPAM: view

Function for GPAM Gene

Molecular function for GPAM Gene

UniProtKB/Swiss-Prot Function:
Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA; Xref=Rhea:RHEA:15325, ChEBI:CHEBI:57287, ChEBI:CHEBI:57597, ChEBI:CHEBI:57970, ChEBI:CHEBI:58342; EC=2.3.1.15;.

Enzyme Numbers (IUBMB) for GPAM Gene

Phenotypes From GWAS Catalog for GPAM Gene

Gene Ontology (GO) - Molecular Function for GPAM Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004366 glycerol-3-phosphate O-acyltransferase activity IMP 18238778
GO:0008374 O-acyltransferase activity IEA --
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
GO:0102420 sn-1-glycerol-3-phosphate C16:0-DCA-CoA acyl transferase activity IEA --
genes like me logo Genes that share ontologies with GPAM: view
genes like me logo Genes that share phenotypes with GPAM: view

Animal Models for GPAM Gene

MGI Knock Outs for GPAM:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GPAM

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for GPAM Gene

Localization for GPAM Gene

Subcellular locations from UniProtKB/Swiss-Prot for GPAM Gene

Mitochondrion outer membrane; Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for GPAM gene
Compartment Confidence
mitochondrion 5
plasma membrane 3
cytosol 3
extracellular 2
peroxisome 2
nucleus 2
endoplasmic reticulum 2
cytoskeleton 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for GPAM Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005739 mitochondrion IEA --
GO:0005741 mitochondrial outer membrane IEA,TAS --
GO:0005886 plasma membrane IEA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with GPAM: view

Pathways & Interactions for GPAM Gene

genes like me logo Genes that share pathways with GPAM: view

UniProtKB/Swiss-Prot Q9HCL2-GPAT1_HUMAN

  • Pathway: Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 1/3.

Gene Ontology (GO) - Biological Process for GPAM Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006072 glycerol-3-phosphate metabolic process IBA 21873635
GO:0006629 lipid metabolic process IEA --
GO:0006631 fatty acid metabolic process IBA 21873635
GO:0006637 acyl-CoA metabolic process IEA --
GO:0006654 phosphatidic acid biosynthetic process TAS --
genes like me logo Genes that share ontologies with GPAM: view

No data available for SIGNOR curated interactions for GPAM Gene

Drugs & Compounds for GPAM Gene

(5) Drugs for GPAM Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Hexanoyl-CoA Experimental Pharma 0
Propanoyl-CoA Experimental Pharma 0
Coenzyme A Investigational Nutra 0

(40) Additional Compounds for GPAM Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
acetyl-coa
  • AcCoA
  • Acetyl coenzyme A
  • S-Acetyl-CoA
  • S-Acetyl-coenzyme A
  • Ac-CoA
72-89-9
glycerol 3-phosphate
  • (R)-Glycerol 1-phosphate
  • D-(Glycerol 1-phosphate)
  • D-Glycerol 1-phosphate
  • Glycerol-3-phosphate
  • Glycerophosphoric acid
57-03-4
(2E)-Decenoyl-CoA
  • (e)-S-2-Decenoate
  • (e)-S-2-Decenoate CoA
  • (e)-S-2-Decenoate coenzyme A
  • (e)-S-2-Decenoic acid
  • 2-trans-Decenoyl-CoA
10018-95-8
(2E)-Dodecenoyl-CoA
1066-12-2
(2E)-Hexadecenoyl-CoA
  • (e)-C16:1 N-14-CoA
  • (e)-Hexadec-2-enoyl-CoA tetraanion
  • (e)-Hexadec-2-enoyl-coenzyme A tetraanion
  • (e)-Hexadec-2-enoyl-coenzyme A(4-)
  • trans-2-Hexadecenoyl-CoA(4-)
4460-95-1
genes like me logo Genes that share compounds with GPAM: view

Transcripts for GPAM Gene

mRNA/cDNA for GPAM Gene

2 REFSEQ mRNAs :
15 NCBI additional mRNA sequence :
4 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GPAM

Alternative Splicing Database (ASD) splice patterns (SP) for GPAM Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8a · 8b ^ 9 ^ 10a · 10b ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^
SP1: - - - -
SP2: - - -
SP3: - -
SP4:
SP5:
SP6: -

ExUns: 21 ^ 22a · 22b ^ 23 ^ 24
SP1: -
SP2:
SP3:
SP4:
SP5:
SP6:

Relevant External Links for GPAM Gene

GeneLoc Exon Structure for
GPAM

Expression for GPAM Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for GPAM Gene

mRNA differential expression in normal tissues according to GTEx for GPAM Gene

This gene is overexpressed in Adipose - Visceral (Omentum) (x11.7), Adipose - Subcutaneous (x9.2), Breast - Mammary Tissue (x5.4), and Liver (x5.1).

Protein differential expression in normal tissues from HIPED for GPAM Gene

This gene is overexpressed in Gallbladder (22.0), Breast (12.9), Liver (12.1), and Adipocyte (8.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for GPAM Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for GPAM

SOURCE GeneReport for Unigene cluster for GPAM Gene:

Hs.42586

Evidence on tissue expression from TISSUES for GPAM Gene

  • Liver(4.6)
  • Nervous system(4.6)
genes like me logo Genes that share expression patterns with GPAM: view

No data available for Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for GPAM Gene

Orthologs for GPAM Gene

This gene was present in the common ancestor of animals.

Orthologs for GPAM Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia GPAM 31 30
  • 99.6 (n)
OneToOne
dog
(Canis familiaris)
Mammalia GPAM 31 30
  • 91.02 (n)
OneToOne
cow
(Bos Taurus)
Mammalia GPAM 31 30
  • 89.49 (n)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia GPAM 31
  • 89 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia GPAM 31
  • 86 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Gpam 30
  • 84.78 (n)
mouse
(Mus musculus)
Mammalia Gpam 17 31 30
  • 84.64 (n)
chicken
(Gallus gallus)
Aves GPAM 31 30
  • 76.18 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia GPAM 31
  • 79 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia MGC145183 30
  • 66.59 (n)
Str.16265 30
African clawed frog
(Xenopus laevis)
Amphibia Xl.15378 30
zebrafish
(Danio rerio)
Actinopterygii gpam 31 30
  • 65.28 (n)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP003687 30
  • 44.08 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG5508 31 30
  • 42.11 (n)
ManyToMany
worm
(Caenorhabditis elegans)
Secernentea acl-6 31 30
  • 43.31 (n)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.6605 31
  • 29 (a)
OneToMany
Species where no ortholog for GPAM was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for GPAM Gene

ENSEMBL:
Gene Tree for GPAM (if available)
TreeFam:
Gene Tree for GPAM (if available)
Aminode:
Evolutionary constrained regions (ECRs) for GPAM: view image

Paralogs for GPAM Gene

Paralogs for GPAM Gene

(5) SIMAP similar genes for GPAM Gene using alignment to 3 proteins:

  • GPAT1_HUMAN
  • Q5VW52_HUMAN
  • Q8N1G6_HUMAN
genes like me logo Genes that share paralogs with GPAM: view

Variants for GPAM Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for GPAM Gene

SNP ID Clinical significance and condition Chr 10 pos Variation AA Info Type
776541 Benign: not provided 112,164,573(-) G/A MISSENSE_VARIANT
776542 Benign: not provided 112,164,616(-) G/GA INTRON_VARIANT
776543 Benign: not provided 112,166,426(-) A/G SYNONYMOUS_VARIANT
rs10787428 - p.Glu131Gly
rs11549703 - p.Ser4Tyr

Additional dbSNP identifiers (rs#s) for GPAM Gene

Structural Variations from Database of Genomic Variants (DGV) for GPAM Gene

Variant ID Type Subtype PubMed ID
nsv475728 CNV novel sequence insertion 20440878
nsv508608 CNV deletion 20534489
nsv7211 OTHER inversion 18451855
nsv831989 CNV gain 17160897

Variation tolerance for GPAM Gene

Residual Variation Intolerance Score: 30% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.36; 53.87% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for GPAM Gene

Human Gene Mutation Database (HGMD)
GPAM
SNPedia medical, phenotypic, and genealogical associations of SNPs for
GPAM

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GPAM Gene

Disorders for GPAM Gene

MalaCards: The human disease database

(2) MalaCards diseases for GPAM Gene - From: DISEASES and Novoseek

- elite association - COSMIC cancer census association via MalaCards
Search GPAM in MalaCards View complete list of genes associated with diseases

Additional Disease Information for GPAM

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with GPAM: view

No data available for UniProtKB/Swiss-Prot and Genatlas for GPAM Gene

Publications for GPAM Gene

  1. AGPAT6 is a novel microsomal glycerol-3-phosphate acyltransferase. (PMID: 18238778) Chen YQ … Cao G (The Journal of biological chemistry 2008) 3 4 23 54
  2. Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10997877) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 2000) 2 3 4 54
  3. Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson SL … O'Brien SJ (PloS one 2010) 3 41 54
  4. A Large-scale genetic association study of esophageal adenocarcinoma risk. (PMID: 20453000) Liu CY … Christiani DC (Carcinogenesis 2010) 3 41 54
  5. Biological, clinical and population relevance of 95 loci for blood lipids. (PMID: 20686565) Teslovich TM … Kathiresan S (Nature 2010) 3 41 54

Products for GPAM Gene

  • Signalway ELISA kits for GPAM
  • Signalway Proteins for GPAM

Sources for GPAM Gene