Free for academic non-profit institutions. Other users need a Commercial license

Aliases for GPAM Gene

Aliases for GPAM Gene

  • Glycerol-3-Phosphate Acyltransferase, Mitochondrial 2 3 5
  • Glycerol-3-Phosphate Acyltransferase 1, Mitochondrial 2 3
  • EC 2.3.1.15 4 56
  • GPAT-1 3 4
  • GPAT1 3 4
  • KIAA1560 4
  • EC 2.3.1 56
  • GPAT 3

External Ids for GPAM Gene

Previous GeneCards Identifiers for GPAM Gene

  • GC10U990097
  • GC10M113575
  • GC10M113899
  • GC10M107537

Summaries for GPAM Gene

Entrez Gene Summary for GPAM Gene

  • This gene encodes a mitochondrial enzyme which prefers saturated fatty acids as its substrate for the synthesis of glycerolipids. This metabolic pathway's first step is catalyzed by the encoded enzyme. Two forms for this enzyme exist, one in the mitochondria and one in the endoplasmic reticulum. Two alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2011]

GeneCards Summary for GPAM Gene

GPAM (Glycerol-3-Phosphate Acyltransferase, Mitochondrial) is a Protein Coding gene. Diseases associated with GPAM include Body Mass Index Quantitative Trait Locus 11. Among its related pathways are Metformin Pathway, Pharmacodynamics and Estrogen Receptor Pathway. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring acyl groups and glycerol-3-phosphate O-acyltransferase activity. An important paralog of this gene is GPAT2.

UniProtKB/Swiss-Prot for GPAM Gene

  • Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.

Gene Wiki entry for GPAM Gene

Additional gene information for GPAM Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for GPAM Gene

Genomics for GPAM Gene

GeneHancer (GH) Regulatory Elements for GPAM Gene

Promoters and enhancers for GPAM Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH10I112182 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE dbSUPER 550.3 +31.6 31563 2.6 HDGF SIN3A ZNF2 POLR2B E2F8 ZNF207 ZNF143 FOS DEK SP3 GPAM TECTB LOC105378486
GH10I112214 Enhancer 0.9 ENCODE dbSUPER 550.8 +0.3 336 1.8 FOXA2 TAF1 MAX MZF1 CEBPG RAD21 YY1 POLR2A PAF1 GATAD2A GPAM LOC105378486
GH10I112222 Enhancer 1 ENCODE dbSUPER 8.4 -8.8 -8822 3.1 ELF3 FOXA2 ZNF48 RAD21 RARA YY1 CREM PAF1 RXRA ELF1 GPAM TECTB LOC101927600
GH10I112274 Enhancer 1.4 FANTOM5 ENCODE dbSUPER 4.5 -60.3 -60322 1.6 FOXA2 ZFP64 ARID4B DMAP1 ETS1 YY1 ATF7 RXRA SP5 REST TECTB GPAM LOC101927600 GC10M112255
GH10I112264 Enhancer 1.1 ENCODE dbSUPER 5.4 -50.2 -50156 2.3 ELF3 FOXA2 MLX RAD21 RARA YY1 RCOR1 CREM THAP11 MIXL1 TECTB GPAM LOC101927600 GC10M112255
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around GPAM on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the GPAM gene promoter:

Genomic Locations for GPAM Gene

Genomic Locations for GPAM Gene
chr10:112,149,864-112,215,395
(GRCh38/hg38)
Size:
65,532 bases
Orientation:
Minus strand
chr10:113,909,622-113,975,135
(GRCh37/hg19)

Genomic View for GPAM Gene

Genes around GPAM on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
GPAM Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for GPAM Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for GPAM Gene

Proteins for GPAM Gene

  • Protein details for GPAM Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9HCL2-GPAT1_HUMAN
    Recommended name:
    Glycerol-3-phosphate acyltransferase 1, mitochondrial
    Protein Accession:
    Q9HCL2
    Secondary Accessions:
    • Q5VW51
    • Q86TA3

    Protein attributes for GPAM Gene

    Size:
    828 amino acids
    Molecular mass:
    93795 Da
    Quaternary structure:
    No Data Available

neXtProt entry for GPAM Gene

Selected DME Specific Peptides for GPAM Gene

Q9HCL2:
  • KAASLCYLLSNEGTISLPCQTFYQ
  • VAVYAESATYCLVKNAVK
  • RPFVGRCC
  • TLVEDFFVMKEEVLARDFDLGFSGNSEDVVMHAIQ
  • HRSHIDY
  • GISYDRIIEGHYNGEQLGKPKKNESLWS
  • GTIDVSYLP
  • FLEGTRSR
  • LAEHILFTASKSCAIMSTHIVACLLLYRHRQGI

Post-translational modifications for GPAM Gene

No Post-translational modifications

Other Protein References for GPAM Gene

Domains & Families for GPAM Gene

Gene Families for GPAM Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted membrane proteins

Suggested Antigen Peptide Sequences for GPAM Gene

Graphical View of Domain Structure for InterPro Entry

Q9HCL2

UniProtKB/Swiss-Prot:

GPAT1_HUMAN :
  • The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
  • Belongs to the GPAT/DAPAT family.
Domain:
  • The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
Family:
  • Belongs to the GPAT/DAPAT family.
genes like me logo Genes that share domains with GPAM: view

Function for GPAM Gene

Molecular function for GPAM Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Acyl-CoA + sn-glycerol 3-phosphate = CoA + 1-acyl-sn-glycerol 3-phosphate.
UniProtKB/Swiss-Prot Function:
Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.

Enzyme Numbers (IUBMB) for GPAM Gene

Phenotypes From GWAS Catalog for GPAM Gene

Gene Ontology (GO) - Molecular Function for GPAM Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004366 glycerol-3-phosphate O-acyltransferase activity IMP 18238778
GO:0008374 O-acyltransferase activity IEA --
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
GO:0102420 sn-1-glycerol-3-phosphate C16:0-DCA-CoA acyl transferase activity IEA --
genes like me logo Genes that share ontologies with GPAM: view
genes like me logo Genes that share phenotypes with GPAM: view

Animal Models for GPAM Gene

MGI Knock Outs for GPAM:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for GPAM Gene

Localization for GPAM Gene

Subcellular locations from UniProtKB/Swiss-Prot for GPAM Gene

Mitochondrion outer membrane; Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for GPAM gene
Compartment Confidence
mitochondrion 5
plasma membrane 2
peroxisome 2
endoplasmic reticulum 2
cytosol 2
nucleus 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for GPAM Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005739 mitochondrion IEA --
GO:0005741 mitochondrial outer membrane IEA,TAS --
GO:0005743 mitochondrial inner membrane IEA --
GO:0005886 plasma membrane IEA --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with GPAM: view

Pathways & Interactions for GPAM Gene

genes like me logo Genes that share pathways with GPAM: view

UniProtKB/Swiss-Prot Q9HCL2-GPAT1_HUMAN

  • Pathway: Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 1/3.

Gene Ontology (GO) - Biological Process for GPAM Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0006631 fatty acid metabolic process IEA --
GO:0006637 acyl-CoA metabolic process IEA --
GO:0006641 triglyceride metabolic process IEA --
GO:0006650 glycerophospholipid metabolic process IEA --
genes like me logo Genes that share ontologies with GPAM: view

No data available for SIGNOR curated interactions for GPAM Gene

Drugs & Compounds for GPAM Gene

(5) Drugs for GPAM Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Hexanoyl-CoA Experimental Pharma 0
Propanoyl-CoA Experimental Pharma 0
Coenzyme A Investigational Nutra 0

(40) Additional Compounds for GPAM Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
acetyl-coa
  • Ac-CoA
  • Ac-Coenzyme A
  • Ac-S-CoA
  • Ac-S-Coenzyme A
  • Acetyl coenzyme-A
72-89-9
glycerol 3-phosphate
  • 1-(Dihydrogen phosphate) Glycerol
  • 1-Glycerophosphate
  • 1-Glycerophosphorate
  • 1-Glycerophosphoric acid
  • 3-Glycerophosphate
57-03-4
(2E)-Decenoyl-CoA
  • (E)-S-2-decenoate
  • (E)-S-2-decenoate CoA
  • (E)-S-2-decenoate Coenzyme A
  • (E)-S-2-decenoic acid
  • 2-trans-Decenoyl-CoA
10018-95-8
(2E)-Dodecenoyl-CoA
  • (2E)-Dodec-2-enoyl-CoA
  • (2E)-Dodec-2-enoyl-Coenzyme A
  • 2-trans-Dodecenoyl-CoA
  • 2-trans-Dodecenoyl-Coenzyme A
1066-12-2
(2E)-Hexadecenoyl-CoA
  • (2E)-Hexadecenoyl-CoA
  • (2E)-Hexadecenoyl-Coenzyme A
  • trans-2-Hexadecenoyl-CoA
  • trans-2-Hexadecenoyl-Coenzyme A
4460-95-1
genes like me logo Genes that share compounds with GPAM: view

Transcripts for GPAM Gene

Unigene Clusters for GPAM Gene

Glycerol-3-phosphate acyltransferase, mitochondrial:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for GPAM Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8a · 8b ^ 9 ^ 10a · 10b ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^
SP1: - - - -
SP2: - - -
SP3: - -
SP4:
SP5:
SP6: -

ExUns: 21 ^ 22a · 22b ^ 23 ^ 24
SP1: -
SP2:
SP3:
SP4:
SP5:
SP6:

Relevant External Links for GPAM Gene

GeneLoc Exon Structure for
GPAM
ECgene alternative splicing isoforms for
GPAM

Expression for GPAM Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for GPAM Gene

mRNA differential expression in normal tissues according to GTEx for GPAM Gene

This gene is overexpressed in Adipose - Visceral (Omentum) (x11.7), Adipose - Subcutaneous (x9.2), Breast - Mammary Tissue (x5.4), and Liver (x5.1).

Protein differential expression in normal tissues from HIPED for GPAM Gene

This gene is overexpressed in Gallbladder (22.0), Breast (12.9), Liver (12.1), and Adipocyte (8.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for GPAM Gene



NURSA nuclear receptor signaling pathways regulating expression of GPAM Gene:

GPAM

SOURCE GeneReport for Unigene cluster for GPAM Gene:

Hs.42586

Evidence on tissue expression from TISSUES for GPAM Gene

  • Liver(4.6)
  • Nervous system(4.6)
genes like me logo Genes that share expression patterns with GPAM: view

Primer Products

No data available for Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for GPAM Gene

Orthologs for GPAM Gene

This gene was present in the common ancestor of animals.

Orthologs for GPAM Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia GPAM 33 34
  • 99.6 (n)
dog
(Canis familiaris)
Mammalia GPAM 33 34
  • 91.02 (n)
cow
(Bos Taurus)
Mammalia GPAM 33 34
  • 89.49 (n)
oppossum
(Monodelphis domestica)
Mammalia GPAM 34
  • 89 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia GPAM 34
  • 86 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Gpam 33
  • 84.78 (n)
mouse
(Mus musculus)
Mammalia Gpam 33 16 34
  • 84.64 (n)
chicken
(Gallus gallus)
Aves GPAM 33 34
  • 76.18 (n)
lizard
(Anolis carolinensis)
Reptilia GPAM 34
  • 79 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia MGC145183 33
  • 66.59 (n)
Str.16265 33
African clawed frog
(Xenopus laevis)
Amphibia Xl.15378 33
zebrafish
(Danio rerio)
Actinopterygii gpam 33 34
  • 65.28 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP003687 33
  • 44.08 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG5508 33 34
  • 42.11 (n)
worm
(Caenorhabditis elegans)
Secernentea acl-6 33 34
  • 43.31 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.6605 34
  • 29 (a)
OneToMany
Species where no ortholog for GPAM was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for GPAM Gene

ENSEMBL:
Gene Tree for GPAM (if available)
TreeFam:
Gene Tree for GPAM (if available)

Paralogs for GPAM Gene

Paralogs for GPAM Gene

(5) SIMAP similar genes for GPAM Gene using alignment to 3 proteins:

genes like me logo Genes that share paralogs with GPAM: view

Variants for GPAM Gene

Sequence variations from dbSNP and Humsavar for GPAM Gene

SNP ID Clin Chr 10 pos Variation AA Info Type
rs1000049470 -- 112,200,379(-) C/G genic_upstream_transcript_variant, intron_variant
rs1000100069 -- 112,200,732(-) T/C genic_upstream_transcript_variant, intron_variant
rs1000167866 -- 112,195,162(-) A/G genic_upstream_transcript_variant, intron_variant
rs1000212317 -- 112,158,209(-) G/A intron_variant
rs1000252104 -- 112,189,106(-) G/T genic_upstream_transcript_variant, intron_variant

Structural Variations from Database of Genomic Variants (DGV) for GPAM Gene

Variant ID Type Subtype PubMed ID
nsv831989 CNV gain 17160897
nsv7211 OTHER inversion 18451855
nsv508608 CNV deletion 20534489
nsv475728 CNV novel sequence insertion 20440878

Variation tolerance for GPAM Gene

Residual Variation Intolerance Score: 30% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.36; 53.87% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for GPAM Gene

Human Gene Mutation Database (HGMD)
GPAM
SNPedia medical, phenotypic, and genealogical associations of SNPs for
GPAM

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GPAM Gene

Disorders for GPAM Gene

MalaCards: The human disease database

(1) MalaCards diseases for GPAM Gene - From: DISEASES and Novoseek

Disorder Aliases PubMed IDs
body mass index quantitative trait locus 11
  • bmiq11
- elite association - COSMIC cancer census association via MalaCards
Search GPAM in MalaCards View complete list of genes associated with diseases

Additional Disease Information for GPAM

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with GPAM: view

No data available for UniProtKB/Swiss-Prot and Genatlas for GPAM Gene

Publications for GPAM Gene

  1. AGPAT6 is a novel microsomal glycerol-3-phosphate acyltransferase. (PMID: 18238778) Chen YQ … Cao G (The Journal of biological chemistry 2008) 3 4 22 58
  2. Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10997877) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 2000) 2 3 4 58
  3. A Large-scale genetic association study of esophageal adenocarcinoma risk. (PMID: 20453000) Liu CY … Christiani DC (Carcinogenesis 2010) 3 44 58
  4. Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson SL … O'Brien SJ (PloS one 2010) 3 44 58
  5. Biological, clinical and population relevance of 95 loci for blood lipids. (PMID: 20686565) Teslovich TM … Kathiresan S (Nature 2010) 3 44 58

Products for GPAM Gene

Sources for GPAM Gene

Content
Loading form....