Free for academic non-profit institutions. Other users need a Commercial license
The protein encoded by this gene is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. Originally thought to be liver-specific, this protein has been found in other tissues as well. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by ... See more...
Aliases for GLS2 Gene
Aliases for GLS2 Gene
External Ids for GLS2 Gene
- HGNC: 29570
- Entrez Gene: 27165
- Ensembl: ENSG00000135423
- OMIM: 606365
- UniProtKB: Q9UI32
Previous GeneCards Identifiers for GLS2 Gene
- GC12M055154
- GC12M055155
- GC12M056864
- GC12M053903
Summaries for GLS2 Gene
-
The protein encoded by this gene is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. Originally thought to be liver-specific, this protein has been found in other tissues as well. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]
GeneCards Summary for GLS2 Gene
GLS2 (Glutaminase 2) is a Protein Coding gene. Diseases associated with GLS2 include Metabolic Acidosis and Juvenile Dermatitis Herpetiformis. Among its related pathways are Circadian entrainment and Gene Expression. Gene Ontology (GO) annotations related to this gene include glutaminase activity. An important paralog of this gene is GLS.
UniProtKB/Swiss-Prot Summary for GLS2 Gene
-
Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant function via NADH and glutathione production. May play a role in preventing tumor proliferation.
No data available for CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for GLS2 Gene
Genomics for GLS2 Gene
GeneHancer (GH) Regulatory Elements for GLS2 Gene
Promoters and enhancers for GLS2 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around GLS2 on UCSC Golden Path with GeneCards custom track
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for GLS2
- Top Transcription factor binding sites by QIAGEN in the GLS2 gene promoter:
-
- AREB6
- ARP-1
- CUTL1
- ER-alpha
- Ik-1
- LCR-F1
- N-Myc
- NRSF form 1
- NRSF form 2
- YY1
Genomic Locations for GLS2 Gene
Genomic Locations for GLS2 Gene
- chr12:56,470,944-56,488,414
- (GRCh38/hg38)
- Size:
- 17,471 bases
- Orientation:
- Minus strand
- chr12:56,864,736-56,882,198
- (GRCh37/hg19)
- Size:
- 17,463 bases
- Orientation:
- Minus strand
Genomic View for GLS2 Gene
Genes around GLS2 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 12q13.3 by HGNC
- 12q13.3 by Entrez Gene
- 12q13.3 by Ensembl
GLS2 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for GLS2 Gene
Proteins for GLS2 Gene
-
Protein details for GLS2 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9UI32-GLSL_HUMAN
- Recommended name:
- Glutaminase liver isoform, mitochondrial
- Protein Accession:
- Q9UI32
- B7Z8Q9
- Q8IX91
- Q9NYY2
- Q9UI31
Protein attributes for GLS2 Gene
- Size:
- 602 amino acids
- Molecular mass:
- 66323 Da
- Quaternary structure:
-
- Homotetramer, dimer of dimers (Probable). Does not assemble into higher oligomers (By similarity). Interacts with the PDZ domain of the syntrophin SNTA1. Interacts with the PDZ domain of TAX1BP3 (PubMed:11163757).
Protein Expression for GLS2 Gene
Selected DME Specific Peptides for GLS2 Gene
- Q9UI32:
-
- NPMVNAGAI
- EAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKS
- SEKETGDRN
- VGKEPSG
- AIGYYLKEKKCFP
- YFQLCSVEVTCES
- DLLFYTIAEGQE
- GFSNATFQSE
- ILLVVPNVMGMMC
- KFVIPDF
- PFCLQSCVKPL
- SNIVLLTQAFR
- DYDSRTALHVAAAEGH
Post-translational modifications for GLS2 Gene
Other Protein References for GLS2 Gene
Antibody Products
- LifeSpan BioSciences GLS2 / Glutaminase 2 Antibody
- Creative Diagnostics Anti-GLS2 (C-terminal) polyclonal antibody
- Creative Biolabs Recombinant Anti-Human GLS2 Antibody
- Novus Biologicals Antibodies for GLS2
-
Abcam antibodies for GLS2
- Invitrogen Antibodies for GLS2 (AFLGC-GLS2)
-
Custom Antibody ServicesProSci Antibodies for GLS2
Protein Products
-
OriGene Purified Proteins for GLS2
- Search Origene for MassSpec and Protein Over-expression Lysates for GLS2
- Origene Custom Protein Services for GLS2
-
Signalway Proteins for GLS2
-
Abcam proteins for GLS2
Assay Products
- antibodies-online: Show 9 available GLS2 Elisa Kits ranked by validation data
- Compare Top GLS2 Elisa Kits
-
Quality Products:
Domains & Families for GLS2 Gene
Gene Families for GLS2 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for GLS2 Gene
- Blocks:
-
- Ankyrin repeat signature
- Glutaminase
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for GLS2 Gene
- GenScript: Design optimal peptide antigens:
-
- cDNA FLJ76505, highly similar to Homo sapiens glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, transcript variant 2, mRNA (A8K0A6_HUMAN)
- cDNA FLJ52925, highly similar to Glutaminase liver isoform, mitochondrial (EC 3.5.1.2) (B7Z8Q9_HUMAN)
- Glutaminase 2 short variant (E5G743_HUMAN)
- Truncated glutaminase 2 (E5G744_HUMAN)
- Truncated glutaminase 2 (E5G745_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q9UI32- Family:
-
- Belongs to the glutaminase family.
Function for GLS2 Gene
Molecular function for GLS2 Gene
- UniProtKB/Swiss-Prot Function:
- Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant function via NADH and glutathione production. May play a role in preventing tumor proliferation.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=H2O + L-glutamine = L-glutamate + NH4(+); Xref=Rhea:RHEA:15889, ChEBI:CHEBI:15377, ChEBI:CHEBI:28938, ChEBI:CHEBI:29985, ChEBI:CHEBI:58359; EC=3.5.1.2; Evidence=. ;.
- UniProtKB/Swiss-Prot Induction:
- Up-regulated by P53 (at protein and mRNA level) under both stressed and non-stressed conditions.
Enzyme Numbers (IUBMB) for GLS2 Gene
Phenotypes From GWAS Catalog for GLS2 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004359 | glutaminase activity | IBA | 21873635 |
| GO:0005515 | protein binding | IPI,IEA | 11163757 |
| GO:0016787 | hydrolase activity | IEA | -- |
Phenotypes for GLS2 Gene
- GenomeRNAi human phenotypes for GLS2:
-
- Increased HPV18 LCR reporter activity
- Decreased shRNA abundance (Z-score < -2)
- Increased shRNA abundance (Z-score > 2)
- Increased homologous recombination repair frequency
- Decreased viability
- no effect
- Increased vaccinia virus (VACV) infection
- Resistant to vaccinia virus (VACV-A4L) infection
- Increased viability
Animal Model Products
-
Taconic Biosciences Mouse Models for GLS2
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for GLS2 - Select products 50% OFF >
- * GLS2 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for GLS2
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for GLS2
- genomics-online: gRNA clones - Search results for available GLS2 gene related products
-
Santa Cruz Biotechnology (SCBT) CRISPR for GLS2
miRNA for GLS2 Gene
- miRTarBase miRNAs that target GLS2
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for GLS2
- Browse OriGene Inhibitory RNA Products For GLS2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GLS2
- genomics-online: shRNA clones - Search results for available GLS2 gene related products
Clone Products
- Applied Biological Materials (abm): Clones for GLS2 - Select products 50% OFF >
- * GLS2 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
- MG221638
- MR221638
- MR221638L1
- MR221638L2
- MR221638L3
- MR221638L4
- MR229325
- MR229778
- RC212650
- RC212650L1
- RC212650L2
- RC212650L3
- RC212650L4
- RC237458
- RC237541
- RC237542
- RG212650
- RR214441
- RR214441L3
- RR214441L4
- RR216945
- RR216984
- MR221638L1V
- MR221638L2V
- MR221638L3V
- MR221638L4V
- RC212650L1V
- RC212650L2V
- RC212650L3V
- RC212650L4V
- RR214441L3V
- RR214441L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for GLS2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for GLS2
- genomics-online: cdna clones - Search results for available GLS2 gene related products
- orf clones - Search results for available GLS2 gene related products
Cell Line Products
-
Horizon Cell Lines for GLS2
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for GLS2 Gene
Localization for GLS2 Gene
Subcellular locations from UniProtKB/Swiss-Prot for GLS2 Gene
- Mitochondrion.
| Compartment | Confidence |
|---|---|
| mitochondrion | 5 |
| nucleus | 3 |
| cytosol | 3 |
| plasma membrane | 2 |
| extracellular | 2 |
| cytoskeleton | 2 |
| peroxisome | 2 |
| endoplasmic reticulum | 2 |
| lysosome | 2 |
| endosome | 1 |
| golgi apparatus | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005739 | mitochondrion | IDA,TAS | 20351271 |
| GO:0005759 | mitochondrial matrix | TAS | -- |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for GLS2 Gene
Pathways & Interactions for GLS2 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | D-Glutamine and D-glutamate metabolism | ||
| 2 | Metabolism |
.40
|
|
| 3 | Gene Expression |
.48
|
|
| 4 | Neurotransmitter Release Cycle | ||
| 5 | Transmission across Chemical Synapses |
.62
|
|
Pathways by source for GLS2 Gene
1 BioSystems pathway for GLS2 Gene
11 Reactome pathways for GLS2 Gene
Interacting Proteins for GLS2 Gene
GPS-Prot Interaction Network for GLS2
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006520 | cellular amino acid metabolic process | TAS | 10620514 |
| GO:0006537 | glutamate biosynthetic process | IBA | 21873635 |
| GO:0006541 | glutamine metabolic process | IEA | -- |
| GO:0006543 | glutamine catabolic process | IBA | 21873635 |
| GO:0008652 | cellular amino acid biosynthetic process | TAS | -- |
No data available for SIGNOR curated interactions for GLS2 Gene
Drugs & Compounds for GLS2 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Ammonia | Approved | Pharma | Enzyme, substrate | 0 | ||
| Glutamic acid | Approved | Nutra | Full agonist, Agonist, Target | 289 | ||
| L-Glutamine | Approved, Investigational | Nutra | Full agonist, Agonist, Enzyme, substrate | 0 | ||
| Famotidine | Approved | Pharma | Histamine H2-receptor antagonist | 73 | ||
| Water | Approved | Pharma | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs |
|---|
Transcripts for GLS2 Gene
mRNA/cDNA for GLS2 Gene
- 5 REFSEQ mRNAs :
- 23 NCBI additional mRNA sequence :
- 17 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000311966 2387 bps (ENST00000311966.9)
- ENST00000390288 1392 bps (ENST00000390288.6)
- ENST00000424141 2225 bps (ENST00000424141.6)
- ENST00000461077 567 bps (ENST00000461077.1)
- ENST00000471282 859 bps (ENST00000471282.5)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for GLS2 - Select products 50% OFF >
- * GLS2 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for GLS2
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for GLS2
- genomics-online: gRNA clones - Search results for available GLS2 gene related products
-
Santa Cruz Biotechnology (SCBT) CRISPR for GLS2
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for GLS2
- Browse OriGene Inhibitory RNA Products For GLS2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GLS2
- genomics-online: shRNA clones - Search results for available GLS2 gene related products
Clone Products
- Applied Biological Materials (abm): Clones for GLS2 - Select products 50% OFF >
- * GLS2 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
- MG221638
- MR221638
- MR221638L1
- MR221638L2
- MR221638L3
- MR221638L4
- MR229325
- MR229778
- RC212650
- RC212650L1
- RC212650L2
- RC212650L3
- RC212650L4
- RC237458
- RC237541
- RC237542
- RG212650
- RR214441
- RR214441L3
- RR214441L4
- RR216945
- RR216984
- MR221638L1V
- MR221638L2V
- MR221638L3V
- MR221638L4V
- RC212650L1V
- RC212650L2V
- RC212650L3V
- RC212650L4V
- RR214441L3V
- RR214441L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for GLS2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for GLS2
- genomics-online: cdna clones - Search results for available GLS2 gene related products
- orf clones - Search results for available GLS2 gene related products
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | · | 1e | ^ | 2 | ^ | 3a | · | 3b | ^ | 4a | · | 4b | · | 4c | ^ | 5a | · | 5b | ^ | 6a | · | 6b | ^ | 7a | · | 7b | · | 7c | · | 7d | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11a | · | 11b | ^ | 12a | · | 12b | ^ |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | - | - | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||
| SP7: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||
| SP9: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP10: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP11: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP12: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP13: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP14: |
| ExUns: | 13 | ^ | 14 | ^ | 15 | ^ | 16a | · | 16b | ^ | 17a | · | 17b | ^ | 18 | ^ | 19a | · | 19b |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | |||||||||||||||||||
| SP2: | |||||||||||||||||||
| SP3: | |||||||||||||||||||
| SP4: | |||||||||||||||||||
| SP5: | |||||||||||||||||||
| SP6: | |||||||||||||||||||
| SP7: | |||||||||||||||||||
| SP8: | |||||||||||||||||||
| SP9: | - | ||||||||||||||||||
| SP10: | |||||||||||||||||||
| SP11: | |||||||||||||||||||
| SP12: | |||||||||||||||||||
| SP13: | |||||||||||||||||||
| SP14: |
Relevant External Links for GLS2 Gene
- GeneLoc Exon Structure for
- GLS2
Expression for GLS2 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Liver (Hepatobiliary System)
- Periportal Hepatocytes Liver Lobule
mRNA differential expression in normal tissues according to GTEx for GLS2 Gene
This gene is overexpressed in Liver (x11.1), Pancreas (x5.8), Brain - Cerebellar Hemisphere (x4.3), and Brain - Cerebellum (x4.1).
This gene is overexpressed in Gallbladder (30.5) and Liver (7.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for GLS2 Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for GLS2
SOURCE GeneReport for Unigene cluster for GLS2 Gene:
Hs.212606mRNA Expression by UniProt/SwissProt for GLS2 Gene:
Q9UI32-GLSL_HUMAN
Tissue specificity:
Highly expressed in liver. Expressed in brain and pancreas. Not observed in heart, placenta, lung, skeletal muscle and kidney. Expression is significantly reduced in hepatocellular carcinomas.
Evidence on tissue expression from TISSUES for GLS2 Gene
- Nervous system(4.8)
- Liver(4.6)
- Blood(2.4)
- Heart(2.3)
- Muscle(2.1)
- Intestine(2)
- Kidney(2)
Primer Products
-
OriGene qPCR primer pairs for GLS2
- genomics-online: primer clones - Search results for available GLS2 gene related products
Gene Expression Assay Products
No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for GLS2 Gene
Orthologs for GLS2 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | GLS2 31 30 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | GLS2 31 30 |
|
OneToOne | |
| cow (Bos Taurus) |
Mammalia | GLS2 31 30 |
|
OneToOne | |
| mouse (Mus musculus) |
Mammalia | Gls2 17 31 30 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Gls2 30 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | GLS2 31 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | -- 31 |
|
OneToMany | |
| -- 31 |
|
OneToMany | |||
| -- 31 |
|
OneToMany | |||
| -- 31 |
|
OneToMany | |||
| lizard (Anolis carolinensis) |
Reptilia | GLS2 31 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | gls2 30 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | si:dkey-102c8.6 30 |
|
||
| gls2 31 |
|
OneToMany | |||
| GLS2 (1 of 3) 31 |
|
OneToMany | |||
| GLS2 (2 of 3) 31 |
|
OneToMany | |||
| fruit fly (Drosophila melanogaster) |
Insecta | CG42708 31 |
|
OneToMany | |
| worm (Caenorhabditis elegans) |
Secernentea | glna-2 31 |
|
ManyToMany | |
| glna-3 31 |
|
ManyToMany | |||
| glna-1 31 |
|
ManyToMany | |||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 31 |
|
OneToOne |
- Species where no ortholog for GLS2 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- chicken (Gallus gallus)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Evolution for GLS2 Gene
- ENSEMBL:
- Gene Tree for GLS2 (if available)
- TreeFam:
- Gene Tree for GLS2 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for GLS2: view image
Paralogs for GLS2 Gene
(3) SIMAP similar genes for GLS2 Gene using alignment to 13 proteins:
- GLSL_HUMAN
- A8K0A6_HUMAN
- B7Z8Q9_HUMAN
- C9J3Q2_HUMAN
- E5G743_HUMAN
- E5G744_HUMAN
- E5G745_HUMAN
- F8WBC9_HUMAN
- F8WBL8_HUMAN
- F8WEU7_HUMAN
- G5E9X4_HUMAN
- L0R6H3_HUMAN
- Q0VD99_HUMAN
Variants for GLS2 Gene
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv2677984 | CNV | deletion | 23128226 |
| esv2745928 | CNV | deletion | 23290073 |
| esv3629598 | CNV | loss | 21293372 |
| nsv1052713 | CNV | gain | 25217958 |
| nsv482992 | CNV | gain+loss | 15286789 |
Residual Variation Intolerance Score:
10.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
4.79;
66.81% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for GLS2 Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GLS2 Gene
Disorders for GLS2 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| metabolic acidosis |
|
|
| juvenile dermatitis herpetiformis |
|
|
| myasthenic syndrome, congenital, 10 |
|
|
| sclerosing keratitis |
|
|
| epileptic encephalopathy, early infantile, 12 |
|
|
Search GLS2 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for GLS2
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for GLS2 Gene
Publications for GLS2 Gene
- Molecular cloning, sequencing and expression studies of the human breast cancer cell glutaminase. (PMID: 10620514) Gómez-Fabre PM … Márquez J (The Biochemical journal 2000) 2 3 4 23 54
- Glutaminase 2, a novel p53 target gene regulating energy metabolism and antioxidant function. (PMID: 20378837) Hu W … Feng Z (Proceedings of the National Academy of Sciences of the United States of America 2010) 3 4 23 54
- Genomic organization and transcriptional analysis of the human l-glutaminase gene. (PMID: 12444921) Pérez-Gómez C … Márquez J (The Biochemical journal 2003) 3 4 23 54
- The C-terminus of human glutaminase L mediates association with PDZ domain-containing proteins. (PMID: 11163757) Olalla L … Márquez J (FEBS letters 2001) 3 4 23 54
- Identification of two human glutaminase loci and tissue-specific expression of the two related genes. (PMID: 11130979) Aledo JC … Márquez J (Mammalian genome : official journal of the International Mammalian Genome Society 2000) 2 3 23 54
ExternalLinks
Products for GLS2 Gene
- Custom Antibody ServicesOriGene Antibodies for GLS2
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for GLS2
- Search Origene for MassSpec and Protein Over-expression Lysates for GLS2
- Origene Custom Protein Services for GLS2
- Origene shrna, sirna, and RNAi products in human, mouse, rat for GLS2
- Browse OriGene Inhibitory RNA Products For GLS2
- OriGene qPCR primer pairs for GLS2
- OriGene CRISPR knockouts for GLS2
- MG221638
- MR221638
- MR221638L1
- MR221638L2
- MR221638L3
- MR221638L4
- MR229325
- MR229778
- RC212650
- RC212650L1
- RC212650L2
- RC212650L3
- RC212650L4
- RC237458
- RC237541
- RC237542
- RG212650
- RR214441
- RR214441L3
- RR214441L4
- RR216945
- RR216984
- MR221638L1V
- MR221638L2V
- MR221638L3V
- MR221638L4V
- RC212650L1V
- RC212650L2V
- RC212650L3V
- RC212650L4V
- RR214441L3V
- RR214441L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For GLS2
- Sino Biological Human cDNA Clone for GLS2
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for GLS2
- Novus Biologicals proteins and lysates for GLS2
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for GLS2
- Abcam proteins for GLS2
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Taconic Biosciences Mouse Models for GLS2
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for GLS2 (AFLGC-GLS2)
- VectorBuilder Custom and pre-made DNA vectors for GLS2 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for GLS2 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for GLS2 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for GLS2 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for GLS2
- antibodies-online: Show 12 available GLS2 Antibodies ranked by validation data
- Compare Top GLS2 Antibodies
- antibodies-online: Show 9 available GLS2 Elisa Kits ranked by validation data
- Compare Top GLS2 Elisa Kits
- Quality Products:
- antibodies-online: Show 5 available GLS2 Proteins ranked by validation data
- Compare Top GLS2 Proteins
- Custom Antibody ServicesProSci Antibodies for GLS2
- Search for GLS2 Proteins at ProSci
- Horizon Cell Lines for GLS2
- genomics-online: cdna clones - Search results for available GLS2 gene related products
- orf clones - Search results for available GLS2 gene related products
- genomics-online: gRNA clones - Search results for available GLS2 gene related products
- genomics-online: primer clones - Search results for available GLS2 gene related products
- genomics-online: shRNA clones - Search results for available GLS2 gene related products
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for GLS2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for GLS2
- Search GeneCopoeia for miRNA 3'UTR Target clone products for GLS2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GLS2
- Search for GLS2 ELISA kits at Signalway
- Signalway Proteins for GLS2
Sources for GLS2 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) H-invDB
- (47) HORDE
- (48) HUGE
- (49) IMGT
- (50) Leiden
- (51) miRBase
- (52) DME
- (53) OriGene
- (54) PubMed
- (55) R&D Systems
- (56) TGDB
- (57) Tocris
- (58) Abcam
- (59) Novus Biologicals
- (60) ProSpec
- (61) Sino Biological
- (62) GenScript
- (63) Qiagen
- (64) OCA
- (65) Proteopedia
- (66) MOPED
- (67) neXtProt
- (68) Reactome
- (69) GeneGo (Thomson Reuters)
- (70) DISEASES
- (71) SIMAP
- (72) GenomeRNAi
- (73) LifeMap
- (74) miRTarBase
- (75) MalaCards
- (76) Invitrogen
- (77) BitterDB
- (78) ESI-BIO
- (79) RefSeq
- (80) BioSystems
- (81) MaxQB
- (82) IUPHAR
- (83) BioGPS
- (84) Illumina
- (85) COMPARTMENTS
- (86) HOMER
- (87) PaxDb
- (88) ApexBio
- (89) Addgene
- (90) antibodies-online
- (91) CYP
- (92) NONCODE
- (93) TreeFam
- (94) PathCards
- (95) GeneReviews
- (96) GeneTex
- (97) Taconic Biosciences
- (98) GTEx
- (99) ProteomicsDB
- (100) SCBT
- (101) DGIdb
- (102) ClinicalTrials
- (103) RVIS
- (104) SIGNOR
- (105) diseasecard
- (106) NIH Rare Diseases
- (107) Orphanet
- (108) UMLS
- (109) GTR
- (110) Disease Ontology
- (111) Genetics Home Reference
- (112) MeSH
- (113) MedlinePlus
- (114) CDC
- (115) NINDS
- (116) NCBI Bookshelf
- (117) ClinVar
- (118) Gene Damage Index
- (119) HPO
- (120) UDN
- (121) VISTA
- (122) FANTOM5
- (123) ENCODE
- (124) ProSci
- (125) Horizon
- (126) The Signaling Pathways Project (SPP)
- (127) IID
- (128) VectorBuilder
- (129) SNPedia
- (130) BRCA Exchange
- (131) CIViC
- (132) ProteoGenix
- (133) dbSUPER
- (134) TISSUES
- (135) Gene ORGANizer
- (136) abm
- (137) Human Protein Atlas
- (138) GWAS Catalog
- (139) Monarch Initiative
- (140) DataMed
- (141) HumanCyc
- (142) genomics-online
- (143) UCNEbase
- (144) EPDnew
- (145) Applied Biosystems
- (146) GlyConnect
- (147) Aminode
- (148) GeneCopoeia
- (149) GPS-Prot
- (150) RNACentral
- (151) LncRNADisease
- (152) LOVD
- (153) miR2Disease
- (154) DiseaseEnhancer
- (155) Boster Bio
- (156) Biorbyt
- (157) Biocompare
- (158) Mastermind
- (159) CTD^2 Dashboard
- (160) CraniofacialAtlas
- (161) GeneImprint
- (162) Synthego
- (163) Bio Basic
- (164) ENA
- (165) GtRNAdb
- (166) LncBase
- (167) LncBook
- (168) LNCipedia
- (169) LncRNAdb
- (170) Modomics
- (171) PDBe
- (172) Rfam
- (173) SILVA
- (174) snOPY
- (175) SRPDB
- (176) GENCODE
- (177) TarBase
- (178) MyBioSource
- (179) Signalway Antibody