This gene is a member of a gene family that encodes enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. The protein encoded by this gene consists of a heavy and a light chain, and it can interact with CT120, a p... See more...

Aliases for GGT7 Gene

Aliases for GGT7 Gene

  • Gamma-Glutamyltransferase 7 2 3 4 5
  • Gamma-Glutamyltransferase-Like 3 2 3 4
  • Gamma-Glutamyltransferase-Like 5 3 4
  • Gamma-Glutamyltranspeptidase 7 3 4
  • Glutathione Hydrolase 7 3 4
  • EC 2.3.2.2 4 51
  • D20S101 2 3
  • GGTL3 3 4
  • GGTL5 3 4
  • GGT 7 3 4
  • Gamma-Glutamyltranspeptidase-Like 3 3
  • Gamma-Glutamyltransferase 4 3
  • EC 3.4.19.13 4
  • DJ18C9.2 2
  • GGT4 3
  • GGT7 5

External Ids for GGT7 Gene

Previous HGNC Symbols for GGT7 Gene

  • GGTL5
  • GGTL3

Previous GeneCards Identifiers for GGT7 Gene

  • GC20M032897
  • GC20M033435
  • GC20M030198

Summaries for GGT7 Gene

Entrez Gene Summary for GGT7 Gene

  • This gene is a member of a gene family that encodes enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. The protein encoded by this gene consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis. [provided by RefSeq, Jul 2008]

GeneCards Summary for GGT7 Gene

GGT7 (Gamma-Glutamyltransferase 7) is a Protein Coding gene. Diseases associated with GGT7 include Glutathionuria and Bladder Sarcoma. Among its related pathways are Cytochrome P450 - arranged by substrate type and Metabolism. Gene Ontology (GO) annotations related to this gene include obsolete gamma-glutamyltransferase activity and glutathione hydrolase activity. An important paralog of this gene is GGT1.

UniProtKB/Swiss-Prot Summary for GGT7 Gene

Gene Wiki entry for GGT7 Gene

Additional gene information for GGT7 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for GGT7 Gene

Genomics for GGT7 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for GGT7 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH20J034872 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 600.7 -1.6 -1643 7.4 SP1 HNRNPL CREB1 GATAD2A CTCF PRDM10 ZNF629 REST TFE3 LEF1 ACSS2 GGT7 PIGU MAP1LC3A PROCR NCOA6 piR-43103-031 MYH7B
GH20J035436 Promoter/Enhancer 1.7 EPDnew Ensembl ENCODE CraniofacialAtlas 33.4 -564.9 -564949 4 HNRNPL CTCF ZNF629 KDM1A PRDM1 ZSCAN4 RXRB PATZ1 REST RAD21 GDF5 UQCC1 RBM12 GGT7 NCOA6 RBM39 AAR2 PROCR ERGIC3 CPNE1
GH20J035659 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 11.3 -790.1 -790083 6.1 HNRNPL CREB1 GATAD2A ATF7 TEAD4 ZNF629 REST PRDM10 TFE3 LEF1 CPNE1 RBM12 lnc-NFS1-2 NFS1 ROMO1 GGT7 PHF20 CEP250 GDF5 MIR1289-1
GH20J034110 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 10.2 +761.0 760995 3.5 CEBPG SP1 HNRNPL CREB1 ATF7 TFE3 ZNF512 RFX1 SIX5 LEF1 EIF2S2 lnc-RALY-4 NCOA6 CDK5RAP1 TRPC4AP ENSG00000272945 ZNF341-AS1 GGT7 CBFA2T2 MAP1LC3A
GH20J035697 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas 10.2 -826.6 -826635 4.2 HNRNPL CREB1 GATAD2A PRDM10 ZNF629 TFE3 SIX5 SOX13 NFKBIZ ZNF692 NONHSAG031688.2 NFS1 ROMO1 CPNE1 RBM12 NCOA6 RBM39 CEP250 ERGIC3 GGT7
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around GGT7 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for GGT7

Top Transcription factor binding sites by QIAGEN in the GGT7 gene promoter:
  • AP-1
  • ATF6
  • Bach1
  • c-Fos
  • c-Jun
  • FosB
  • Fra-1
  • JunB
  • JunD
  • MZF-1

Genomic Locations for GGT7 Gene

Genomic Locations for GGT7 Gene
chr20:34,844,720-34,872,858
(GRCh38/hg38)
Size:
28,139 bases
Orientation:
Minus strand
chr20:33,432,523-33,460,663
(GRCh37/hg19)
Size:
28,141 bases
Orientation:
Minus strand

Genomic View for GGT7 Gene

Genes around GGT7 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
GGT7 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for GGT7 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for GGT7 Gene

Proteins for GGT7 Gene

  • Protein details for GGT7 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UJ14-GGT7_HUMAN
    Recommended name:
    Glutathione hydrolase 7
    Protein Accession:
    Q9UJ14
    Secondary Accessions:
    • Q8N899
    • Q8NF66
    • Q9BYP5
    • Q9BYP6

    Protein attributes for GGT7 Gene

    Size:
    662 amino acids
    Molecular mass:
    70467 Da
    Quaternary structure:
    • Heterodimer composed of the light and heavy chains. The active site is located in the light chain (By similarity). Isoform 3 interacts with TLCD3A.
    SequenceCaution:
    • Sequence=BAC03394.1; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305};

    Alternative splice isoforms for GGT7 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for GGT7 Gene

Selected DME Specific Peptides for GGT7 Gene

Q9UJ14:
  • ECSCRQDGLTVIVTACLTFATGVTVAL
  • EKPVCGVYRGHLVLSP
  • PLRGRKDEDAFLGDPDTDPDSFLKSARLQRLPSSSSEMGS
  • MQIYFGDPQIF
  • PPLPGSLL
  • PGKRPLS
  • PPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIA

Post-translational modifications for GGT7 Gene

  • Glycosylation at Asn330, Asn353, Asn198, Asn267, Asn283, Asn394, Asn452, Asn519, Asn523, and Asn586
  • Modification sites at PhosphoSitePlus
  • Glycosylation from GlyConnect

Domains & Families for GGT7 Gene

Gene Families for GGT7 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for GGT7 Gene

InterPro:
Blocks:
  • Gamma-glutamyltranspeptidase
ProtoNet:

Suggested Antigen Peptide Sequences for GGT7 Gene

GenScript: Design optimal peptide antigens:
  • GGT7 protein (A0PJJ9_HUMAN)
  • GGT7 protein (A4FU32_HUMAN)
  • GGT7 protein (A4IF34_HUMAN)
  • Gamma-glutamyltransferase 7 (A5D8W8_HUMAN)
  • Gamma-glutamyltranspeptidase 7 (GGT7_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9UJ14

UniProtKB/Swiss-Prot:

GGT7_HUMAN :
  • Belongs to the gamma-glutamyltransferase family.
Family:
  • Belongs to the gamma-glutamyltransferase family.
genes like me logo Genes that share domains with GGT7: view

Function for GGT7 Gene

Molecular function for GGT7 Gene

UniProtKB/Swiss-Prot Function:
Cleaves glutathione conjugates.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide]; Xref=Rhea:RHEA:23904, Rhea:RHEA-COMP:9780, Rhea:RHEA-COMP:9795, ChEBI:CHEBI:77644, ChEBI:CHEBI:78597, ChEBI:CHEBI:78599, ChEBI:CHEBI:78608; EC=2.3.2.2;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=glutathione + H2O = L-cysteinylglycine + L-glutamate; Xref=Rhea:RHEA:28807, ChEBI:CHEBI:15377, ChEBI:CHEBI:29985, ChEBI:CHEBI:57925, ChEBI:CHEBI:61694; EC=3.4.19.13;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate; Xref=Rhea:RHEA:59468, ChEBI:CHEBI:15377, ChEBI:CHEBI:29985, ChEBI:CHEBI:90779, ChEBI:CHEBI:143103; EC=3.4.19.13;.

Enzyme Numbers (IUBMB) for GGT7 Gene

Phenotypes From GWAS Catalog for GGT7 Gene

Gene Ontology (GO) - Molecular Function for GGT7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000048 peptidyltransferase activity IBA 21873635
GO:0005515 protein binding IPI 25416956
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with GGT7: view
genes like me logo Genes that share phenotypes with GGT7: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GGT7

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for GGT7 Gene

Localization for GGT7 Gene

Subcellular locations from UniProtKB/Swiss-Prot for GGT7 Gene

Membrane. Single-pass type II membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for GGT7 gene
Compartment Confidence
plasma membrane 5
extracellular 2
cytosol 2
cytoskeleton 1
mitochondrion 1
nucleus 1
endoplasmic reticulum 1
lysosome 1
peroxisome 0

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoplasm (2)
  • Vesicles (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for GGT7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005886 plasma membrane IBA 21873635
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with GGT7: view

Pathways & Interactions for GGT7 Gene

genes like me logo Genes that share pathways with GGT7: view

Pathways by source for GGT7 Gene

1 GeneGo (Thomson Reuters) pathway for GGT7 Gene
  • Glutathione metabolism

UniProtKB/Swiss-Prot Q9UJ14-GGT7_HUMAN

  • Pathway: Sulfur metabolism; glutathione metabolism.

Gene Ontology (GO) - Biological Process for GGT7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006412 translation IEA --
GO:0006508 proteolysis IEA --
GO:0006749 glutathione metabolic process IEA --
GO:0006750 glutathione biosynthetic process IEA --
GO:0006751 glutathione catabolic process IEA,IBA 21873635
genes like me logo Genes that share ontologies with GGT7: view

No data available for SIGNOR curated interactions for GGT7 Gene

Drugs & Compounds for GGT7 Gene

(9) Drugs for GGT7 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Carbon dioxide Approved, Investigational, Vet_approved Pharma 0
Famotidine Approved Pharma Histamine H2-receptor antagonist 82
Water Approved Pharma 0
Glutamic acid Approved Nutra Agonist, Full agonist 304
Glutathione Approved, Investigational Nutra 0

(8) Additional Compounds for GGT7 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
5-L-Glutamyl-taurine
  • 5-Glutamyl-taurine
  • Glutaurine
  • alpha-Glutamyl taurine
  • gamma-L-Glutamyltaurine
  • gamma-L-Glutamyl-taurine
beta-Aminopropionitrile
  • 2-Cyanoethylamine
  • 3-Aminopropionitrile
  • 3-Aminopropiononitrile
  • Aminopropionitrile
  • BAPN
151-18-8
cysteinylglycine
  • CG
  • Cys-gly
  • N-L-Cysteinylglycine
  • L-Cysteinylglycine
  • N-Cysteinyl glycine
19246-18-5
gamma-Glutamyl-beta-aminopropiononitrile
  • gamma-Glutamyl-3-aminopropiononitrile
  • g-Glutamyl-3-aminopropiononitrile
  • γ-glutamyl-3-aminopropiononitrile
  • g-Glutamyl-b-aminopropiononitrile
  • γ-glutamyl-β-aminopropiononitrile
gamma-Glutamyl-beta-cyanoalanine
genes like me logo Genes that share compounds with GGT7: view

Transcripts for GGT7 Gene

mRNA/cDNA for GGT7 Gene

2 REFSEQ mRNAs :
15 NCBI additional mRNA sequence :
4 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GGT7

Alternative Splicing Database (ASD) splice patterns (SP) for GGT7 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3a · 3b · 3c ^ 4a · 4b · 4c · 4d ^ 5a · 5b · 5c ^ 6a · 6b · 6c · 6d · 6e ^ 7 ^ 8a · 8b · 8c ^ 9a · 9b · 9c ·
SP1: - - - - - - -
SP2: - - -
SP3: - - - - -
SP4: - - - -
SP5: -
SP6: - - - -
SP7: - - -
SP8: - - - - - - - -
SP9:
SP10: - -
SP11: -
SP12:
SP13:

ExUns: 9d ^ 10a · 10b ^ 11 ^ 12a · 12b ^ 13 ^ 14a · 14b ^ 15 ^ 16a · 16b ^ 17
SP1:
SP2:
SP3:
SP4:
SP5: -
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12: -
SP13:

Relevant External Links for GGT7 Gene

GeneLoc Exon Structure for
GGT7

Expression for GGT7 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for GGT7 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for GGT7 Gene

This gene is overexpressed in Frontal cortex (23.5), Brain (9.7), and Retina (6.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for GGT7 Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for GGT7

SOURCE GeneReport for Unigene cluster for GGT7 Gene:

Hs.433738

mRNA Expression by UniProt/SwissProt for GGT7 Gene:

Q9UJ14-GGT7_HUMAN
Tissue specificity: Widely expressed, but at low level, except in the airway epithelial cells. Detected in brain, heart, kidney, liver, lung, spleen, testis and trachea.

Evidence on tissue expression from TISSUES for GGT7 Gene

  • Spleen(4.3)
  • Nervous system(4.2)
  • Liver(2.7)
  • Kidney(2.6)
  • Lung(2.2)
genes like me logo Genes that share expression patterns with GGT7: view

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for GGT7 Gene

Orthologs for GGT7 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for GGT7 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia GGT7 30 31
  • 97.81 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia GGT7 30 31
  • 91.99 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia GGT7 30 31
  • 91.34 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Ggt7 30 17 31
  • 89.88 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Ggt7 30
  • 89.02 (n)
Oppossum
(Monodelphis domestica)
Mammalia GGT7 31
  • 87 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia GGT7 31
  • 77 (a)
OneToOne
Chicken
(Gallus gallus)
Aves GGT7 30 31
  • 68.19 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia GGT7 31
  • 69 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia ggt7 30
  • 62.16 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.9126 30
Zebrafish
(Danio rerio)
Actinopterygii LOC101882295 30
  • 59.58 (n)
GGT7 31
  • 54 (a)
OneToOne
Worm
(Caenorhabditis elegans)
Secernentea Y97E10AR.2 31
  • 13 (a)
OneToOne
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes ECM38 31
  • 21 (a)
OneToMany
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.5921 31
  • 30 (a)
OneToOne
Species where no ortholog for GGT7 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Fruit Fly (Drosophila melanogaster)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for GGT7 Gene

ENSEMBL:
Gene Tree for GGT7 (if available)
TreeFam:
Gene Tree for GGT7 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for GGT7: view image

Paralogs for GGT7 Gene

Paralogs for GGT7 Gene

(1) SIMAP similar genes for GGT7 Gene using alignment to 6 proteins:

  • GGT7_HUMAN
  • A0PJJ9_HUMAN
  • A2A2G5_HUMAN
  • A4FU32_HUMAN
  • A4IF34_HUMAN
  • A5D8W8_HUMAN
genes like me logo Genes that share paralogs with GGT7: view

Variants for GGT7 Gene

Additional dbSNP identifiers (rs#s) for GGT7 Gene

Structural Variations from Database of Genomic Variants (DGV) for GGT7 Gene

Variant ID Type Subtype PubMed ID
esv3567955 CNV loss 25503493
nsv1055447 CNV loss 25217958
nsv954027 CNV deletion 24416366
nsv964393 CNV duplication 23825009

Variation tolerance for GGT7 Gene

Residual Variation Intolerance Score: 31.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.76; 33.37% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for GGT7 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
GGT7

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for GGT7 Gene

Disorders for GGT7 Gene

MalaCards: The human disease database

(3) MalaCards diseases for GGT7 Gene - From: DISEASES

Disorder Aliases PubMed IDs
glutathionuria
  • gamma-glutamyltranspeptidase deficiency
bladder sarcoma
  • sarcoma of bladder
blood group incompatibility
- elite association - COSMIC cancer census association via MalaCards
Search GGT7 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for GGT7

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
genes like me logo Genes that share disorders with GGT7: view

No data available for UniProtKB/Swiss-Prot and Genatlas for GGT7 Gene

Publications for GGT7 Gene

  1. The human gamma-glutamyltransferase gene family. (PMID: 18357469) Heisterkamp N … Sneddon TP (Human genetics 2008) 2 3 4
  2. Molecular cloning and characterization of CT120, a novel membrane-associated gene involved in amino acid transport and glutathione metabolism. (PMID: 12270127) He X … Gu J (Biochemical and biophysical research communications 2002) 3 4 23
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 41
  4. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4
  5. Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones. (PMID: 12693554) Jikuya H … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 2003) 3 4

Products for GGT7 Gene

Sources for GGT7 Gene