Aliases for GANAB Gene
Aliases for GANAB Gene
External Ids for GANAB Gene
- HGNC: 4138
- Entrez Gene: 23193
- Ensembl: ENSG00000089597
- OMIM: 104160
- UniProtKB: Q14697
Previous GeneCards Identifiers for GANAB Gene
- GC11U990054
- GC11M062166
- GC11M062148
- GC11M062430
- GC11M058721
- GC11M062481
- GC11M062675
- GC11M062689
- GC11M062718
- GC11M062729
- GC11M062740
- GC11M062756
- GC11M062770
Summaries for GANAB Gene
-
This gene encodes the alpha subunit of glucosidase II and a member of the glycosyl hydrolase 31 family of proteins. The heterodimeric enzyme glucosidase II plays a role in protein folding and quality control by cleaving glucose residues from immature glycoproteins in the endoplasmic reticulum. Expression of the encoded protein is elevated in lung tumor tissue and in response to UV irradiation. Mutations in this gene cause autosomal-dominant polycystic kidney and liver disease. [provided by RefSeq, Jul 2016]
GeneCards Summary for GANAB Gene
GANAB (Glucosidase II Alpha Subunit) is a Protein Coding gene. Diseases associated with GANAB include Polycystic Kidney Disease 3 and Autosomal Dominant Polycystic Kidney Disease. Among its related pathways are Metabolism of proteins and Transport to the Golgi and subsequent modification. Gene Ontology (GO) annotations related to this gene include hydrolase activity, hydrolyzing O-glycosyl compounds. An important paralog of this gene is GANC.
UniProtKB/Swiss-Prot for GANAB Gene
-
Cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins (PubMed:10929008). Required for PKD1/Polycystin-1 and PKD2/Polycystin-2 maturation and localization to the cell surface and cilia (PubMed:27259053).
-
Glycosylases are a group of enzymes that includes glucosidases, mannosidases and heparanases. There are two glucosidase subtypes, both found in the gut. They hydrolyze terminal (1,4)alpha-glucosidic linkages and (1,6)beta-glucosidic linkages, liberating alpha-glucose and beta-glucose.
Additional gene information for GANAB Gene
- Monarch Initiative
- Search for GANAB at DataMed
- Search for GANAB at HumanCyc
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for GANAB Gene
Genomics for GANAB Gene
GeneHancer (GH) Regulatory Elements for GANAB Gene
Promoters and enhancers for GANAB Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around GANAB on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Locations for GANAB Gene
Genomic Locations for GANAB Gene
- chr11:62,624,826-62,646,726
- (GRCh38/hg38)
- Size:
- 21,901 bases
- Orientation:
- Minus strand
- chr11:62,392,298-62,414,104
- (GRCh37/hg19)
Genomic View for GANAB Gene
Genes around GANAB on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 11q12.3 by Ensembl
- 11q12.3 by Entrez Gene
- 11q12.3 by HGNC
GANAB Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for GANAB Gene
Proteins for GANAB Gene
-
Protein details for GANAB Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q14697-GANAB_HUMAN
- Recommended name:
- Neutral alpha-glucosidase AB
- Protein Accession:
- Q14697
- A6NC20
- Q8WTS9
- Q9P0X0
Protein attributes for GANAB Gene
- Size:
- 944 amino acids
- Molecular mass:
- 106874 Da
- Quaternary structure:
-
- Heterodimer of a catalytic alpha subunit (GANAB) and a beta subunit (PRKCSH). Binds glycosylated PTPRC (By similarity).
- SequenceCaution:
-
- Sequence=AAH65266.1; Type=Erroneous translation; Note=Wrong choice of CDS.; Evidence={ECO:0000305};
Protein Expression for GANAB Gene
Selected DME Specific Peptides for GANAB Gene
- Q14697:
-
- RAFFAGSQR
- IVDPHIK
- LKISIPM
- GELFLDDGHTFNY
- WNDMNEPS
- ARLSVSG
- GSQRFGAVWTGDNTAEWDHLKISIPMCLSL
- YVHMATADGL
- AAVAARRRRSW
- WNDMNEPSVFNGPEV
- GAYQPFFR
- YRLYNLDV
- PFRLDLLEDRSLLLSVNARGL
- GGWEHRD
- FSLGYHQ
- PFFRAHAH
- FEHQRAPRV
Post-translational modifications for GANAB Gene
Other Protein References for GANAB Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Novus Biologicals Antibodies for GANAB
-
Abcam antibodies for GANAB
-
Cloud-Clone Corp. Antibodies for GANAB
- Invitrogen Antibodies for GANAB
- GeneTex GANAB antibody for GANAB
Protein Products
-
OriGene Purified Proteins for GANAB
- Search Origene for MassSpec and Protein Over-expression Lysates for GANAB
- Origene Custom Protein Services for GANAB
-
Cloud-Clone Corp. Proteins for GANAB
- antibodies-online: Search results for 7 available GANAB Proteins ranked by validation data
- Compare Top GANAB Proteins
-
Quality Products:
- Search GeneTex for Proteins for GANAB
-
Abcam proteins for GANAB
Assay Products
- antibodies-online: Search results for 1 available GANAB Elisa Kits ranked by validation data
- Compare Top GANAB Elisa Kits
-
Quality Products:
Domains & Families for GANAB Gene
Gene Families for GANAB Gene
- Human Protein Atlas (HPA):
-
- Disease related genes
- Enzymes
- FDA approved drug targets
- Plasma proteins
- Predicted intracellular proteins
- Predicted secreted proteins
Protein Domains for GANAB Gene
Suggested Antigen Peptide Sequences for GANAB Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q14697- Family:
-
- Belongs to the glycosyl hydrolase 31 family.
Function for GANAB Gene
Molecular function for GANAB Gene
- GENATLAS Biochemistry:
- glucosidase,alpha-,neutral AB
- UniProtKB/Swiss-Prot CatalyticActivity:
- Hydrolysis of terminal (1->3)-alpha-D-glucosidic links in (1->3)-alpha-D-glucans.
- UniProtKB/Swiss-Prot Function:
- Cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins (PubMed:10929008). Required for PKD1/Polycystin-1 and PKD2/Polycystin-2 maturation and localization to the cell surface and cilia (PubMed:27259053).
Enzyme Numbers (IUBMB) for GANAB Gene
Phenotypes From GWAS Catalog for GANAB Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0003723 | RNA binding | HDA | 22658674 |
| GO:0003824 | catalytic activity | IEA | -- |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds | IEA | -- |
| GO:0016787 | hydrolase activity | IEA | -- |
| GO:0016798 | hydrolase activity, acting on glycosyl bonds | IEA | -- |
Phenotypes for GANAB Gene
- GenomeRNAi human phenotypes for GANAB:
Animal Model Products
-
Taconic Biosciences Mouse Models for GANAB
- Cyagen custom Knockout/knockin (KOKI) mouse models for GANAB
-
-
ViGene Biosciences lentiviral particle packaged cDNA for GANAB gene
-
ViGene Biosciences ready-to-package AAV shRNAs for GANAB gene
- Search ViGene Biosciences for GANAB
CRISPR Products
-
OriGene CRISPR knockouts for GANAB
- genomics-online: gRNA clones - Search results for 132 available GANAB gene related products
- Overview of 132 available GANAB gene related products
- Applied Biological Materials CRISPR for GANAB
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for GANAB
- GenScript: Design CRISPR guide RNA sequences for GANAB
miRNA for GANAB Gene
- miRTarBase miRNAs that target GANAB
-
- hsa-mir-1296-5p (MIRT036101)
- hsa-mir-93-3p (MIRT038734)
- hsa-mir-615-3p (MIRT040196)
- hsa-mir-484 (MIRT041824)
- hsa-mir-324-5p (MIRT043197)
- hsa-mir-125b-5p (MIRT046015)
- hsa-mir-23b-3p (MIRT046294)
- hsa-mir-222-3p (MIRT046817)
- hsa-mir-181b-5p (MIRT047273)
- hsa-mir-181a-5p (MIRT047329)
- hsa-mir-34a-5p (MIRT047360)
- hsa-mir-107 (MIRT048291)
- hsa-mir-92a-3p (MIRT049013)
- hsa-mir-17-5p (MIRT050974)
- hsa-mir-3619-5p (MIRT052860)
- hsa-mir-155-5p (MIRT440588)
- hsa-mir-629-3p (MIRT725499)
- hsa-mir-515-5p (MIRT725500)
- hsa-mir-519e-5p (MIRT725501)
- hsa-mir-29a-5p (MIRT725502)
- hsa-mir-497-3p (MIRT725503)
- hsa-mir-136-5p (MIRT725504)
- hsa-mir-16-5p (MIRT727602)
- hsa-mir-195-5p (MIRT727603)
- hsa-mir-15b-5p (MIRT727604)
- hsa-mir-15a-5p (MIRT727605)
- hsa-mir-1273a (MIRT736756)
- hsa-mir-1273c (MIRT736762)
- hsa-mir-1273g-5p (MIRT736835)
- hsa-mir-1291 (MIRT737113)
- hsa-mir-146b-3p (MIRT737647)
- hsa-mir-203a-5p (MIRT738808)
- hsa-mir-29b-2-5p (MIRT739574)
- hsa-mir-3074-5p (MIRT739717)
- hsa-mir-6775-3p (MIRT755353)
- hsa-mir-7152-5p (MIRT759195)
- hsa-mir-7160-3p (MIRT759300)
miRNA Products
- Search ViGene Biosciences for GANAB
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for GANAB
- Browse OriGene Inhibitory RNA Products For GANAB
- genomics-online: shRNA clones - Search results for 132 available GANAB gene related products
- Overview of 132 available GANAB gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for GANAB gene
Clone Products
- Sino Biological Human cDNA Clone for GANAB
- VectorBuilder custom plasmid, inducible vectors for GANAB
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for GANAB
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for GANAB
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for GANAB
-
ViGene Biosciences adenoviral particle packaged cDNA for GANAB gene
-
ViGene Biosciences lentiviral particle packaged cDNA for GANAB gene
-
ViGene Biosciences ready-to-package AAV shRNAs for GANAB gene
No data available for Animal Models , Transcription Factor Targets and HOMER Transcription for GANAB Gene
Localization for GANAB Gene
Subcellular locations from UniProtKB/Swiss-Prot for GANAB Gene
- Endoplasmic reticulum. Golgi apparatus. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| endoplasmic reticulum | 5 |
| golgi apparatus | 4 |
| plasma membrane | 2 |
| nucleus | 2 |
| cytosol | 2 |
| lysosome | 2 |
| peroxisome | 1 |
- Cytosol (2)
- Endoplasmic reticulum (2)
- Nuclear membrane (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005783 | endoplasmic reticulum | IEA | -- |
| GO:0005788 | endoplasmic reticulum lumen | TAS | -- |
| GO:0005794 | Golgi apparatus | IEA | -- |
| GO:0016020 | membrane | IDA,HDA | 19946888 |
| GO:0017177 | glucosidase II complex | IEA | -- |
Pathways & Interactions for GANAB Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Calnexin/calreticulin cycle | ||
| 2 | Metabolism of proteins | ||
| 3 | Metabolism | ||
| 4 | N-Glycan biosynthesis | ||
| 5 | Protein processing in endoplasmic reticulum | ||
Pathways by source for GANAB Gene
3 KEGG pathways for GANAB Gene
UniProtKB/Swiss-Prot Q14697-GANAB_HUMAN
- Pathway: Glycan metabolism; N-glycan metabolism.
Interacting Proteins for GANAB Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005975 | carbohydrate metabolic process | IEA | -- |
| GO:0006457 | protein folding | TAS | -- |
| GO:0008152 | metabolic process | IEA | -- |
No data available for SIGNOR curated interactions for GANAB Gene
Drugs & Compounds for GANAB Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Miglitol | Approved | Pharma | Target, antagonist | 12 | ||
| Voglibose | Approved, Investigational | Pharma | α-glucosidases inhibitor | 23 | ||
| D-glucose | Approved | Pharma | 0 | |||
| Water | Approved | Pharma | 0 | |||
| Acarbose | Approved, Investigational | Pharma | Alpha-glucosidase inhibitor, Glucosidase alpha inhibitor (intestinal) | 91 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| Miglustat hydrochloride |
|
210110-90-0 |
|
|
(5) Tocris Compounds for GANAB Gene
| Compound | Action | Cas Number |
|---|---|---|
| 1-Deoxymannojirimycin hydrochloride | alpha-Mannosidase I inhibitor | 73465-43-7 |
| 1-Deoxynojirimycin | Glucosidase I and II inhibitor | 19130-96-2 |
| Acarbose | Glucosidase alpha inhibitor (intestinal) | 56180-94-0 |
| Castanospermine | Glucosidases alpha and beta inhibitor | 79831-76-8 |
| Miglustat hydrochloride | alpha-glucosidase I and II inhibitor. Also inhibits ceramide-specific glycosyltransferases | 210110-90-0 |
(3) ApexBio Compounds for GANAB Gene
| Compound | Action | Cas Number |
|---|---|---|
| N-Nonyldeoxynojirimycin | 81117-35-3 | |
| Sinensetin | α-glucosidase inhibitor, selective | 2306-27-6 |
| Voglibose | α-glucosidases inhibitor | 83480-29-9 |
Transcripts for GANAB Gene
mRNA/cDNA for GANAB Gene
- (13) REFSEQ mRNAs :
- (14) Additional mRNA sequences :
- (914) Selected AceView cDNA sequences:
- (16) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for GANAB Gene
CRISPR Products
-
OriGene CRISPR knockouts for GANAB
- genomics-online: gRNA clones - Search results for 132 available GANAB gene related products
- Overview of 132 available GANAB gene related products
- Applied Biological Materials CRISPR for GANAB
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for GANAB
- GenScript: Design CRISPR guide RNA sequences for GANAB
miRNA Products
- Search ViGene Biosciences for GANAB
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for GANAB
- Browse OriGene Inhibitory RNA Products For GANAB
- genomics-online: shRNA clones - Search results for 132 available GANAB gene related products
- Overview of 132 available GANAB gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for GANAB gene
Clone Products
- Sino Biological Human cDNA Clone for GANAB
- VectorBuilder custom plasmid, inducible vectors for GANAB
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for GANAB
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for GANAB
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5a | · | 5b | · | 5c | ^ | 6a | · | 6b | ^ | 7a | · | 7b | · | 7c | · | 7d | · | 7e | ^ | 8a | · | 8b | ^ | 9a | · | 9b | ^ | 10a | · | 10b | · | 10c | ^ | 11a | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP9: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP10: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP11: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP12: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP13: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP14: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP15: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP16: | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||
| SP17: | - |
| ExUns: | 11b | ^ | 12a | · | 12b | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16 | ^ | 17 | ^ | 18 | ^ | 19 | ^ | 20 | ^ | 21 | ^ | 22a | · | 22b | ^ | 23 | ^ | 24 | ^ | 25a | · | 25b | · | 25c |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||||||||||||||||||||||||||||||||
| SP2: | - | ||||||||||||||||||||||||||||||||||||
| SP3: | |||||||||||||||||||||||||||||||||||||
| SP4: | |||||||||||||||||||||||||||||||||||||
| SP5: | |||||||||||||||||||||||||||||||||||||
| SP6: | |||||||||||||||||||||||||||||||||||||
| SP7: | |||||||||||||||||||||||||||||||||||||
| SP8: | |||||||||||||||||||||||||||||||||||||
| SP9: | |||||||||||||||||||||||||||||||||||||
| SP10: | |||||||||||||||||||||||||||||||||||||
| SP11: | |||||||||||||||||||||||||||||||||||||
| SP12: | |||||||||||||||||||||||||||||||||||||
| SP13: | |||||||||||||||||||||||||||||||||||||
| SP14: | |||||||||||||||||||||||||||||||||||||
| SP15: | |||||||||||||||||||||||||||||||||||||
| SP16: | |||||||||||||||||||||||||||||||||||||
| SP17: |
Expression for GANAB Gene
This gene is overexpressed in Lymph node (8.2).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for GANAB Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of GANAB Gene:
GANABSOURCE GeneReport for Unigene cluster for GANAB Gene:
Hs.595071mRNA Expression by UniProt/SwissProt for GANAB Gene:
Q14697-GANAB_HUMAN
Tissue specificity:
Detected in placenta (PubMed:3881423). Isoform 1 and isoform 2 are expressed in the kidney and liver (PubMed:27259053).
Evidence on tissue expression from TISSUES for GANAB Gene
- Nervous system(5)
- Intestine(4.6)
- Liver(4.5)
- Bone marrow(4.3)
- Lung(4.2)
- Kidney(3.4)
- Eye(3.1)
- Pancreas(3.1)
- Skin(3.1)
- Thyroid gland(2.7)
- Stomach(2.4)
- Blood(2.1)
- Muscle(2)
Primer Products
-
OriGene qPCR primer pairs for GANAB
- genomics-online: primer clones - Search results for 132 available GANAB gene related products
- Overview of 132 available GANAB gene related products
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for GANAB Gene
Orthologs for GANAB Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | GANAB 33 34 |
|
||
| dog (Canis familiaris) |
Mammalia | GANAB 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | GANAB 33 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Ganab 33 16 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Ganab 33 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | GANAB 34 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | -- 34 |
|
ManyToMany | |
| lizard (Anolis carolinensis) |
Reptilia | -- 34 |
|
OneToMany | |
| -- 34 |
|
OneToMany | |||
| tropical clawed frog (Silurana tropicalis) |
Amphibia | ganab 33 |
|
||
| Str.3740 33 |
|
||||
| zebrafish (Danio rerio) |
Actinopterygii | LOC100334924 33 |
|
||
| GANAB (1 of 3) 34 |
|
OneToMany | |||
| GANAB (3 of 3) 34 |
|
OneToMany | |||
| GANAB (2 of 3) 34 |
|
OneToMany | |||
| fruit fly (Drosophila melanogaster) |
Insecta | CG14476 33 34 |
|
||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP000862 33 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | aagr-3 33 34 |
|
||
| aagr-4 34 |
|
ManyToMany | |||
| A. gosspyii yeast (Ashbya gossypii) |
Saccharomycetes | AGOS_AAR173C 33 |
|
||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | ROT2 33 34 36 |
|
||
| K. lactis yeast (Kluyveromyces lactis) |
Saccharomycetes | KLLA0F09735g 33 |
|
||
| thale cress (Arabidopsis thaliana) |
eudicotyledons | RSW3 33 |
|
||
| Alicante grape (Vitis vinifera) |
eudicotyledons | Vvi.3471 33 |
|
||
| rice (Oryza sativa) |
Liliopsida | Os03g0216600 33 |
|
||
| Os.6168 33 |
|
||||
| barley (Hordeum vulgare) |
Liliopsida | Hv.10182 33 |
|
||
| bread mold (Neurospora crassa) |
Ascomycetes | NCU04203 33 |
|
||
| fission yeast (Schizosaccharomyces pombe) |
Schizosaccharomycetes | gls2 33 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToMany | |
| sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.3796 33 |
|
- Species where no ortholog for GANAB was found in the sources mined by GeneCards:
-
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- beta proteobacteria (Neisseria meningitidis)
- chicken (Gallus gallus)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for GANAB Gene
(2) SIMAP similar genes for GANAB Gene using alignment to 6 proteins:
Variants for GANAB Gene
| SNP ID | Clin | Chr 11 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs752158933 | pathogenic, Polycystic kidney disease 3 | 62,639,458(-) | TCTCT/TCT | 5_prime_UTR_variant, coding_sequence_variant, frameshift, intron_variant | |
| rs770519542 | pathogenic, Polycystic kidney disease 3, Polycystic kidney disease 3 (PKD3) [MIM:600666] | 62,630,788(-) | C/A/T | coding_sequence_variant, missense_variant | |
| rs879255641 | pathogenic, Polycystic kidney disease 3 | 62,629,281(-) | CT/ | coding_sequence_variant, frameshift | |
| rs879255642 | pathogenic, Polycystic kidney disease 3, Polycystic kidney disease 3 (PKD3) [MIM:600666] | 62,631,032(-) | G/C | coding_sequence_variant, missense_variant | |
| rs879255643 | pathogenic, Polycystic kidney disease 3, Polycystic kidney disease 3 (PKD3) [MIM:600666] | 62,626,633(-) | G/A | coding_sequence_variant, missense_variant |
Residual Variation Intolerance Score:
27.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
4.24;
62.35% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for GANAB Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GANAB Gene
Disorders for GANAB Gene
(5) MalaCards diseases for GANAB Gene - From: HGMD, OMIM, ClinVar, GTR, Orphanet, Swiss-Prot, DISEASES, and GeneCards
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| polycystic kidney disease 3 |
|
|
| autosomal dominant polycystic kidney disease |
|
|
| polycystic liver disease |
|
|
| polycystic kidney disease |
|
|
| glycogen storage disease ii |
|
|
Search GANAB in MalaCards
View complete list of genes associated with diseases
UniProtKB/Swiss-Prot
GANAB_HUMAN- Polycystic kidney disease 3 (PKD3) [MIM:600666]: A form of polycystic kidney disease, a disorder characterized by progressive formation and enlargement of cysts in both kidneys, typically leading to end-stage renal disease in adult life. Cysts also occur in other organs, particularly the liver. PKD3 inheritance is autosomal dominant. {ECO:0000269 PubMed:27259053}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Additional Disease Information for GANAB
No data available for Genatlas for GANAB Gene
Publications for GANAB Gene
- Identity of neutral alpha-glucosidase AB and the glycoprotein processing enzyme glucosidase II. Biochemical and genetic studies. (PMID: 3881423) Martiniuk F … Hirschhorn R (The Journal of biological chemistry 1985) 2 3 4 58
- Mutations in GANAB, Encoding the Glucosidase IIα Subunit, Cause Autosomal-Dominant Polycystic Kidney and Liver Disease. (PMID: 27259053) Porath B … Harris PC (American journal of human genetics 2016) 3 4 58
- Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes. (PMID: 17081065) Chi A … Hunt DF (Journal of proteome research 2006) 3 4 58
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
- The alpha- and beta-subunits are required for expression of catalytic activity in the hetero-dimeric glucosidase II complex from human liver. (PMID: 10764838) Treml K … Bause E (Glycobiology 2000) 2 3 58
Products for GANAB Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for GANAB
- Search Origene for MassSpec and Protein Over-expression Lysates for GANAB
- Origene Custom Protein Services for GANAB
- Origene shrna, sirna, and RNAi products in human, mouse, rat for GANAB
- Browse OriGene Inhibitory RNA Products For GANAB
- OriGene qPCR primer pairs for GANAB
- OriGene CRISPR knockouts for GANAB
- OriGene ORF clones in human for GANAB
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For GANAB
- GenScript: Next-day shipping of latest version cDNA ORF clones for GANAB in any vector
- GenScript Custom Purified and Recombinant Proteins Services for GANAB
- GenScript Custom Assay Services for GANAB
- GenScript Custom overexpressing Cell Line Services for GANAB
- GenScript: Design CRISPR guide RNA sequences for GANAB
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for GANAB
- Sino Biological Human cDNA Clone for GANAB
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for GANAB
- Novus Biologicals lysates and proteins for GANAB
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for GANAB
- Abcam proteins for GANAB
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Cloud-Clone Corp. Antibodies for GANAB
- Cloud-Clone Corp. Proteins for GANAB
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Taconic Biosciences Mouse Models for GANAB
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for GANAB
- ApexBio compounds for GANAB
- Cyagen custom Knockout/knockin (KOKI) mouse models for GANAB
- VectorBuilder custom plasmid, inducible vectors for GANAB
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for GANAB
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 58 available GANAB Antibodies ranked by validation data
- Compare Top GANAB Antibodies
- antibodies-online: Search results for 1 available GANAB Elisa Kits ranked by validation data
- Compare Top GANAB Elisa Kits
- Quality Products:
- antibodies-online: Search results for 7 available GANAB Proteins ranked by validation data
- Compare Top GANAB Proteins
- Quality Products:
- GeneTex GANAB antibody for GANAB
- Search GeneTex for Proteins for GANAB
- ViGene Biosciences adenoviral particle packaged cDNA for GANAB gene
- ViGene Biosciences lentiviral particle packaged cDNA for GANAB gene
- ViGene Biosciences ready-to-package AAV shRNAs for GANAB gene
- Search ViGene Biosciences for GANAB
- Horizon Cell Lines for GANAB
- genomics-online: cdna clones - Search results for 132 available GANAB gene related products
- Overview of 132 available GANAB gene related products
- orf clones - Search results for 132 available GANAB gene related products
- Overview of 132 available GANAB gene related products
- genomics-online: gRNA clones - Search results for 132 available GANAB gene related products
- Overview of 132 available GANAB gene related products
- genomics-online: primer clones - Search results for 132 available GANAB gene related products
- Overview of 132 available GANAB gene related products
- genomics-online: shRNA clones - Search results for 132 available GANAB gene related products