Free for academic non-profit institutions. Other users need a Commercial license
This gene encodes GalNAc transferase 7, a member of the GalNAc-transferase family. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. ... See more...
Aliases for GALNT7 Gene
Aliases for GALNT7 Gene
- Polypeptide N-Acetylgalactosaminyltransferase 7 2 3 5
- Polypeptide GalNAc Transferase 7 2 3 4
- UDP-N-Acetyl-Alpha-D-Galactosamine:Polypeptide N-Acetylgalactosaminyltransferase 7 (GalNAc-T7) 2 3
- UDP-GalNAc:Polypeptide N-Acetylgalactosaminyltransferase 7 3 4
- Protein-UDP Acetylgalactosaminyltransferase 7 3 4
- N-Acetylgalactosaminyltransferase 7 3 4
- Pp-GaNTase 7 3 4
External Ids for GALNT7 Gene
- HGNC: 4129
- NCBI Entrez Gene: 51809
- Ensembl: ENSG00000109586
- OMIM®: 605005
- UniProtKB/Swiss-Prot: Q86SF2
Previous GeneCards Identifiers for GALNT7 Gene
- GC04P175010
- GC04P174627
- GC04P174785
- GC04P174464
- GC04P174326
- GC04P174089
- GC04P169916
Summaries for GALNT7 Gene
-
This gene encodes GalNAc transferase 7, a member of the GalNAc-transferase family. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. Unlike other family members, this enzyme shows exclusive specificity for partially GalNAc-glycosylated acceptor substrates and shows no activity with non-glycosylated peptides. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation. [provided by RefSeq, Jul 2008]
GeneCards Summary for GALNT7 Gene
GALNT7 (Polypeptide N-Acetylgalactosaminyltransferase 7) is a Protein Coding gene. Among its related pathways are O-linked glycosylation and Metabolism of proteins. Gene Ontology (GO) annotations related to this gene include carbohydrate binding and polypeptide N-acetylgalactosaminyltransferase activity. An important paralog of this gene is GALNT1.
UniProtKB/Swiss-Prot Summary for GALNT7 Gene
-
Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified.
Additional gene information for GALNT7 Gene
- HGNC (4129)
- NCBI Entrez Gene (51809)
- Ensembl (ENSG00000109586)
- OMIM® (605005)
- UniProtKB/Swiss-Prot (Q86SF2)
- Open Targets Platform(ENSG00000109586)
- Search for GALNT7 at DataMed
- Search for GALNT7 at HumanCyc
No data available for CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for GALNT7 Gene
Genomics for GALNT7 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for GALNT7 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around GALNT7 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for GALNT7
- Top Transcription factor binding sites by QIAGEN in the GALNT7 gene promoter:
-
- AML1a
- Evi-1
- FOXD3
- FOXJ2
- FOXJ2 (long isoform)
- FOXL1
- POU2F1
- POU2F1a
- RSRFC4
- Sox9
Genomic Locations for GALNT7 Gene
Latest Assembly
- chr4:173,168,811-173,323,967
- (GRCh38/hg38)
- Size:
- 155,157 bases
- Orientation:
- Plus strand
Previous Assembly
- chr4:174,089,962-174,245,118
- (GRCh37/hg19 by Entrez Gene)
- Size:
- 155,157 bases
- Orientation:
- Plus strand
- chr4:174,089,904-174,245,118
- (GRCh37/hg19 by Ensembl)
- Size:
- 155,215 bases
- Orientation:
- Plus strand
Genomic View for GALNT7 Gene
Genes around GALNT7 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 4q34.1 by HGNC
- 4q34.1 by Entrez Gene
- 4q34.1 by Ensembl
GALNT7 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for GALNT7 Gene
Proteins for GALNT7 Gene
-
Protein details for GALNT7 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q86SF2-GALT7_HUMAN
- Recommended name:
- N-acetylgalactosaminyltransferase 7
- Protein Accession:
- Q86SF2
- B3KQU3
- Q7Z5W7
- Q9UJ28
Protein attributes for GALNT7 Gene
- Size:
- 657 amino acids
- Molecular mass:
- 75389 Da
- Cofactor:
- Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Quaternary structure:
- No Data Available
Protein Expression for GALNT7 Gene
Selected DME Specific Peptides for GALNT7 Gene
- Q86SF2:
-
- MAGGLFA
- ENLLTSS
- QASIKEFGFNM
- RTVHSVI
- ASDMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNE
- GNTYEIIPQGGGDEDGYARGAWDWSMLWKRVPLT
- SGKCLDRSEVLHQVFIS
- NCKSFKWFM
- PCSRVGH
Post-translational modifications for GALNT7 Gene
Other Protein References for GALNT7 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibodies for research
- LifeSpan BioSciences GALNT7 Antibody
-
Custom Antibody ServicesOriGene Antibodies for GALNT7
- Novus Biologicals Antibodies for GALNT7
-
Abcam antibodies for GALNT7
- Invitrogen Antibodies for GALNT7 (AFLGC-GALNT7)
- Sino Biological Antibodies for GALNT7
Protein products for research
-
OriGene Purified Proteins for GALNT7
- Search Origene for MassSpec and Protein Over-expression Lysates for GALNT7
- Origene Custom Protein Services for GALNT7
- Sino Biological Recombinant Proteins for GALNT7
- Sino Biological Cell Lysates for GALNT7
- antibodies-online: Show 11 available GALNT7 Proteins ranked by validation data
- Compare Top GALNT7 Proteins
-
Quality Products:
-
ProSci Proteins for GALNT7
-
Abcam proteins for GALNT7
Assay products for research
- RayBiotech Custom Human GALNT7 ELISA
- antibodies-online: Show 3 available GALNT7 Elisa Kits ranked by validation data
- Compare Top GALNT7 Elisa Kits
-
Quality Products:
Domains & Families for GALNT7 Gene
Gene Families for GALNT7 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Predicted intracellular proteins
Protein Domains for GALNT7 Gene
- InterPro:
- Blocks:
-
- Ricin B lectin domain
- Glycosyl transferase, family 2
- ProtoNet:
Suggested Antigen Peptide Sequences for GALNT7 Gene
- GenScript: Design optimal peptide antigens:
-
- cDNA FLJ57113, highly similar to N-acetylgalactosaminyltransferase 7 (EC 2.4.1.-) (B4DIB4_HUMAN)
- UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7 (GALT7_HUMAN)
- Polypeptide N-acetylgalactosaminyltransferase 7 (Q68VJ4_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q86SF2UniProtKB/Swiss-Prot:
GALT7_HUMAN :- There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
- Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
- Domain:
-
- There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
- The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.
- Family:
-
- Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
Function for GALNT7 Gene
Molecular function for GALNT7 Gene
- UniProtKB/Swiss-Prot Function:
- Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=L-seryl-[protein] + UDP-N-acetyl-alpha-D-galactosamine = 3-O-[N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + H(+) + UDP; Xref=Rhea:RHEA:23956, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:12788, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:53604, ChEBI:CHEBI:58223, ChEBI:CHEBI:67138; EC=2.4.1.41; Evidence={ECO:0000269|PubMed:10544240, ECO:0000269|PubMed:11925450};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=L-threonyl-[protein] + UDP-N-acetyl-alpha-D-galactosamine = 3-O-[N-acetyl-alpha-D-galactosaminyl]-L-threonyl-[protein] + H(+) + UDP; Xref=Rhea:RHEA:52424, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11689, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:58223, ChEBI:CHEBI:67138, ChEBI:CHEBI:87075; EC=2.4.1.41; Evidence={ECO:0000269|PubMed:10544240, ECO:0000269|PubMed:11925450};.
Enzyme Numbers (IUBMB) for GALNT7 Gene
Phenotypes From GWAS Catalog for GALNT7 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004653 | polypeptide N-acetylgalactosaminyltransferase activity | IEA | -- |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0016757 | transferase activity, transferring glycosyl groups | IEA | -- |
| GO:0030246 | carbohydrate binding | IEA | -- |
| GO:0046872 | metal ion binding | IEA | -- |
Phenotypes for GALNT7 Gene
Animal Models for research
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for GALNT7 - Starting at $85 >
- * GALNT7 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for GALNT7
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for GALNT7
-
Santa Cruz Biotechnology (SCBT) CRISPR for GALNT7
miRNA for GALNT7 Gene
- miRTarBase miRNAs that target GALNT7
-
- hsa-miR-16-5p (MIRT001466)
- hsa-miR-30a-5p (MIRT005150)
- hsa-miR-378a-3p (MIRT005424)
- hsa-miR-214-3p (MIRT006816)
- mmu-miR-324-3p (MIRT010732)
- mmu-miR-26a-5p (MIRT011181)
- mmu-miR-30e-5p (MIRT013232)
- mmu-miR-136-5p (MIRT014895)
- hsa-miR-374b-5p (MIRT016045)
- hsa-miR-124-3p (MIRT023185)
- hsa-miR-26b-5p (MIRT030348)
- hsa-miR-17-3p (MIRT035525)
- hsa-miR-154-5p (MIRT093510)
- hsa-miR-125b-2-3p (MIRT093523)
- hsa-miR-4731-3p (MIRT093525)
- hsa-miR-4801 (MIRT093526)
- hsa-miR-25-3p (MIRT093529)
- hsa-miR-32-5p (MIRT093530)
- hsa-miR-92a-3p (MIRT093531)
- hsa-miR-363-3p (MIRT093532)
- hsa-miR-367-3p (MIRT093533)
- hsa-miR-92b-3p (MIRT093534)
- hsa-miR-660-5p (MIRT093535)
- hsa-miR-548k (MIRT093536)
- hsa-miR-4282 (MIRT093537)
- hsa-miR-3973 (MIRT093538)
- hsa-miR-219b-3p (MIRT093539)
- hsa-miR-5591-3p (MIRT093540)
- hsa-miR-548av-5p (MIRT093541)
- hsa-miR-8054 (MIRT093542)
- hsa-miR-5700 (MIRT400883)
- hsa-miR-34c-5p (MIRT438415)
- hsa-miR-34b-3p (MIRT438416)
- hsa-miR-34a-5p (MIRT438417)
- hsa-miR-552-5p (MIRT537228)
- hsa-miR-4666a-5p (MIRT537229)
- hsa-miR-374a-5p (MIRT567465)
- hsa-miR-8064 (MIRT567466)
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for GALNT7
- Browse OriGene Inhibitory RNA Products For GALNT7
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GALNT7
Clone products for research
- Applied Biological Materials (abm): Clones for GALNT7 - Starting at $45 >
- * GALNT7 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for GALNT7
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for GALNT7
Cell Lines for research
-
Horizon Cell Lines for GALNT7
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for GALNT7 Gene
Localization for GALNT7 Gene
Subcellular locations from UniProtKB/Swiss-Prot for GALNT7 Gene
- Golgi apparatus membrane. Single-pass type II membrane protein.
| Compartment | Confidence |
|---|---|
| golgi apparatus | 5 |
| extracellular | 4 |
| endoplasmic reticulum | 2 |
| plasma membrane | 1 |
| cytoskeleton | 1 |
| mitochondrion | 1 |
| nucleus | 1 |
| endosome | 1 |
| lysosome | 1 |
| peroxisome | 0 |
- Golgi apparatus (2)
- Nucleoplasm (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000139 | Golgi membrane | IEA,TAS | -- |
| GO:0005794 | Golgi apparatus | IEA,IBA | 21873635 |
| GO:0016020 | membrane | IEA,HDA | 19946888 |
| GO:0016021 | integral component of membrane | IEA | -- |
| GO:0070062 | extracellular exosome | HDA | 23533145 |
Pathways & Interactions for GALNT7 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Mucin type O-glycan biosynthesis | ||
| 2 | Metabolism of proteins | ||
| 3 | O-linked glycosylation | ||
| 4 | Metabolism | ||
Pathways by source for GALNT7 Gene
1 BioSystems pathway for GALNT7 Gene
4 Reactome pathways for GALNT7 Gene
3 KEGG pathways for GALNT7 Gene
UniProtKB/Swiss-Prot Q86SF2-GALT7_HUMAN
- Pathway: Protein modification; protein glycosylation.
Interacting Proteins for GALNT7 Gene
GPS-Prot Interaction Network for GALNT7
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005975 | carbohydrate metabolic process | TAS | 10544240 |
| GO:0006486 | protein glycosylation | IEA | -- |
| GO:0006493 | protein O-linked glycosylation | IEA,TAS | 10544240 |
| GO:0016266 | O-glycan processing | TAS | -- |
| GO:0018215 | protein phosphopantetheinylation | IEA | -- |
No data available for SIGNOR curated interactions for GALNT7 Gene
Drugs & Compounds for GALNT7 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| Lactosamine |
|
13000-25-4 |
|
|||
| Uridine diphosphate-N-acetylgalactosamine |
|
7277-98-7 |
|
Drug products for research
Transcripts for GALNT7 Gene
mRNA/cDNA for GALNT7 Gene
- 4 REFSEQ mRNAs :
- 9 NCBI additional mRNA sequence :
- 7 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000265000 4249 nts (view in UCSC)
- ENST00000502407 568 nts (view in UCSC)
- ENST00000503213 648 nts (view in UCSC)
- ENST00000505308 1658 nts (view in UCSC)
- ENST00000506317 583 nts (view in UCSC)
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for GALNT7 - Starting at $85 >
- * GALNT7 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for GALNT7
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for GALNT7
-
Santa Cruz Biotechnology (SCBT) CRISPR for GALNT7
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for GALNT7
- Browse OriGene Inhibitory RNA Products For GALNT7
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GALNT7
Clone products for research
- Applied Biological Materials (abm): Clones for GALNT7 - Starting at $45 >
- * GALNT7 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for GALNT7
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for GALNT7
| ExUns: | 1a | · | 1b | ^ | 2a | · | 2b | ^ | 3 | ^ | 4 | ^ | 5a | · | 5b | ^ | 6 | ^ | 7a | · | 7b | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | ^ | 11a | · | 11b | ^ | 12 | ^ | 13a | · | 13b |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | |||||||||||||||||||||||||||||||||||
| SP2: | |||||||||||||||||||||||||||||||||||||||
| SP3: | |||||||||||||||||||||||||||||||||||||||
| SP4: | |||||||||||||||||||||||||||||||||||||||
| SP5: |
Relevant External Links for GALNT7 Gene
- GeneLoc Exon Structure for
- GALNT7
Expression for GALNT7 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Brain (Nervous System)
-
Testis (Reproductive System)
- Pre-Sertoli Cells Testis Cord
- Gut Tube (Gastrointestinal Tract)
- Neural Tube (Nervous System)
- Kidney (Urinary System)
- Eye (Sensory Organs)
This gene is overexpressed in Oral epithelium (20.6) and Breast (11.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for GALNT7 Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for GALNT7
SOURCE GeneReport for Unigene cluster for GALNT7 Gene:
Hs.548088mRNA Expression by UniProt/SwissProt for GALNT7 Gene:
Q86SF2-GALT7_HUMAN
Tissue specificity:
Widely expressed. Expressed in uterus, retina, kidney, small intestine, omentum, stomach and CNS.
Evidence on tissue expression from TISSUES for GALNT7 Gene
- Nervous system(3.5)
- Intestine(3)
- Lung(2.8)
- Stomach(2.7)
- Gall bladder(2.3)
Primer products for research
-
OriGene qPCR primer pairs for GALNT7
-
OriGene qPCR primer pairs and template standards for GALNT7
Gene Expression Assays for research
No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for GALNT7 Gene
Orthologs for GALNT7 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | GALNT7 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | GALNT7 31 |
|
OneToOne | |
| LOC102152620 30 |
|
||||
| Rat (Rattus norvegicus) |
Mammalia | Galnt7 30 |
|
||
| Mouse (Mus musculus) |
Mammalia | Galnt7 30 17 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | GALNT7 30 31 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | GALNT7 31 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | GALNT7 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | GALNT7 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | GALNT7 31 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | galnt7 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | galnt7 30 31 |
|
OneToOne | |
| Fruit Fly (Drosophila melanogaster) |
Insecta | GalNAc-T2 30 31 |
|
OneToOne | |
| CG2103 32 |
|
|
|||
| CG6394 32 |
|
|
|||
| CG7297 32 |
|
|
|||
| CG7304 32 32 |
|
|
|||
| CG7579 32 32 |
|
|
|||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP000656 30 |
|
||
| Worm (Caenorhabditis elegans) |
Secernentea | gly-7 30 31 32 |
|
OneToOne | |
| Y45F10D.3 32 |
|
|
|||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | -- 31 |
|
OneToOne |
- Species where no ortholog for GALNT7 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for GALNT7 Gene
- ENSEMBL:
- Gene Tree for GALNT7 (if available)
- TreeFam:
- Gene Tree for GALNT7 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for GALNT7: view image
Paralogs for GALNT7 Gene
Paralogs for GALNT7 Gene
(21) SIMAP similar genes for GALNT7 Gene using alignment to 6 proteins:
- GALT7_HUMAN
- E9PBY3_HUMAN
- H0YAH3_HUMAN
- H0YAK0_HUMAN
- Q4W5F7_HUMAN
- Q68VJ4_HUMAN
Variants for GALNT7 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for GALNT7 Gene
| SNP ID | Clinical significance and condition | Chr 04 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs35177744 | Benign: not provided | 173,302,131(+) |
T/C NM_017423.3(GALNT7):c.1233T>C (p.Ile411=) |
SYNONYMOUS_VARIANT,INTRON | |
| rs61741158 | Benign: not provided | 173,314,029(+) |
G/T NM_017423.3(GALNT7):c.1461G>T (p.Ser487=) |
SYNONYMOUS |
All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv9397n54 | CNV | gain | 21841781 |
| esv24067 | CNV | loss | 19812545 |
| esv3303175 | CNV | mobile element insertion | 20981092 |
| esv3307933 | CNV | mobile element insertion | 20981092 |
| esv3340436 | CNV | insertion | 20981092 |
| esv3351993 | CNV | insertion | 20981092 |
| esv3397362 | CNV | insertion | 20981092 |
| esv3603210 | CNV | loss | 21293372 |
| nsv1074239 | CNV | deletion | 25765185 |
| nsv1120145 | OTHER | inversion | 24896259 |
| nsv4610 | CNV | deletion | 18451855 |
| nsv518900 | CNV | gain | 19592680 |
| nsv527434 | CNV | gain | 19592680 |
| nsv596224 | CNV | loss | 21841781 |
| nsv596232 | CNV | gain | 21841781 |
Residual Variation Intolerance Score:
33.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
2.31;
41.32% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for GALNT7 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- GALNT7
SNP Genotyping and Copy Number Assays for research
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GALNT7 Gene
Disorders for GALNT7 Gene
Additional Disease Information for GALNT7
- Atlas
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
- Open Targets Platform
No disorders were found for GALNT7 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for GALNT7 Gene
Publications for GALNT7 Gene
- A novel human UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase, GalNAc-T7, with specificity for partial GalNAc-glycosylated acceptor substrates. (PMID: 10544240) Bennett EP … Clausen H (FEBS letters 1999) 2 3 4
- MicroRNA miR-378 regulates nephronectin expression modulating osteoblast differentiation by targeting GalNT-7. (PMID: 19844573) Kahai S … Yang BB (PloS one 2009) 3 23
- Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. (PMID: 16303743) Otsuki T … Isogai T (DNA research : an international journal for rapid publication of reports on genes and genomes 2005) 3 4
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
- A trimeric Rab7 GEF controls NPC1-dependent lysosomal cholesterol export. (PMID: 33144569) van den Boomen DJH … Lehner PJ (Nature communications 2020) 3
ExternalLinks
Products for GALNT7 Gene
- Custom Antibody ServicesOriGene Antibodies for GALNT7
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for GALNT7
- Search Origene for MassSpec and Protein Over-expression Lysates for GALNT7
- Origene Custom Protein Services for GALNT7
- Origene shrna, sirna, and RNAi products in human, mouse, rat for GALNT7
- Browse OriGene Inhibitory RNA Products For GALNT7
- OriGene qPCR primer pairs for GALNT7
- OriGene qPCR primer pairs and template standards for GALNT7
- OriGene CRISPR knockouts for GALNT7
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For GALNT7
- Sino Biological Human cDNA Clone for GALNT7
- Sino Biological Recombinant Proteins for GALNT7
- Sino Biological Cell Lysates for GALNT7
- Sino Biological Antibodies for GALNT7
- Browse Sino Biological Assays
- Browse Recombinant Proteins
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for GALNT7
- Novus Biologicals proteins and lysates for GALNT7
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for GALNT7
- Abcam proteins for GALNT7
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Invitrogen Antibodies for GALNT7 (AFLGC-GALNT7)
- VectorBuilder Custom and pre-made DNA vectors for GALNT7 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for GALNT7 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for GALNT7 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for GALNT7 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for GALNT7
- antibodies-online: Show 8 available GALNT7 Antibodies ranked by validation data
- Compare Top GALNT7 Antibodies
- antibodies-online: Show 3 available GALNT7 Elisa Kits ranked by validation data
- Compare Top GALNT7 Elisa Kits
- Quality Products:
- antibodies-online: Show 11 available GALNT7 Proteins ranked by validation data
- Compare Top GALNT7 Proteins
- Quality Products:
- Custom Antibody ServicesProSci Antibodies for GALNT7
- ProSci Proteins for GALNT7
- Horizon Cell Lines for GALNT7
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for GALNT7
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for GALNT7
- Search GeneCopoeia for miRNA 3'UTR Target clone products for GALNT7
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for GALNT7
Sources for GALNT7 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM® (Updated: 05-Mar-2021)
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) MedlinePlus Genetics
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNAcentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Open Targets Platform
- (175) 5SRRNADB
- (176) snoDB
- (177) MirGeneDB