This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating pr... See more...

Aliases for G3BP1 Gene

Aliases for G3BP1 Gene

  • G3BP Stress Granule Assembly Factor 1 2 3 5
  • GTPase Activating Protein (SH3 Domain) Binding Protein 1 2 3
  • Ras-GTPase-Activating Protein SH3-Domain-Binding Protein 2 3
  • Ras GTPase-Activating Protein-Binding Protein 1 3 4
  • GAP SH3 Domain-Binding Protein 1 3 4
  • ATP-Dependent DNA Helicase VIII 3 4
  • DNA Helicase VIII 2 3
  • G3BP-1 3 4
  • G3BP 3 4
  • RasGAP-Associated Endoribonuclease G3BP 3
  • GAP Binding Protein 3
  • EC 3.6.4.12 4
  • EC 3.6.4.13 4
  • HDH-VIII 3
  • HDH VIII 4
  • EC 3.6.1 52

External Ids for G3BP1 Gene

Previous GeneCards Identifiers for G3BP1 Gene

  • GC05P151132
  • GC05P151151
  • GC05P146296

Summaries for G3BP1 Gene

Entrez Gene Summary for G3BP1 Gene

  • This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008]

GeneCards Summary for G3BP1 Gene

G3BP1 (G3BP Stress Granule Assembly Factor 1) is a Protein Coding gene. Diseases associated with G3BP1 include Astrocytoma and Chikungunya. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and mRNA binding. An important paralog of this gene is G3BP2.

UniProtKB/Swiss-Prot Summary for G3BP1 Gene

  • ATP- and magnesium-dependent helicase that plays an essential role in innate immunity (PubMed:30510222). Participates in the DNA-triggered cGAS/STING pathway by promoting the DNA binding and activation of CGAS. Enhances also DDX58-induced type I interferon production probably by helping DDX58 at sensing pathogenic RNA (PubMed:30804210). In addition, plays an essential role in stress granule formation (PubMed:12642610, PubMed:20180778, PubMed:23279204). Unwinds preferentially partial DNA and RNA duplexes having a 17 bp annealed portion and either a hanging 3' tail or hanging tails at both 5'- and 3'-ends (PubMed:9889278). Unwinds DNA/DNA, RNA/DNA, and RNA/RNA substrates with comparable efficiency (PubMed:9889278). Acts unidirectionally by moving in the 5' to 3' direction along the bound single-stranded DNA (PubMed:9889278). Phosphorylation-dependent sequence-specific endoribonuclease in vitro (PubMed:11604510). Cleaves exclusively between cytosine and adenine and cleaves MYC mRNA preferentially at the 3'-UTR (PubMed:11604510).

Gene Wiki entry for G3BP1 Gene

Additional gene information for G3BP1 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for G3BP1 Gene

Genomics for G3BP1 Gene

GeneHancer (GH) Regulatory Elements for G3BP1 Gene

Promoters and enhancers for G3BP1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around G3BP1 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for G3BP1

Top Transcription factor binding sites by QIAGEN in the G3BP1 gene promoter:
  • Arnt
  • ATF
  • p53
  • Pax-4a
  • PPAR-gamma1
  • PPAR-gamma2

Genomic Locations for G3BP1 Gene

Genomic Locations for G3BP1 Gene
chr5:151,771,045-151,812,785
(GRCh38/hg38)
Size:
41,741 bases
Orientation:
Plus strand
chr5:151,150,606-151,192,346
(GRCh37/hg19)
Size:
41,741 bases
Orientation:
Plus strand

Genomic View for G3BP1 Gene

Genes around G3BP1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
G3BP1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for G3BP1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for G3BP1 Gene

Proteins for G3BP1 Gene

  • Protein details for G3BP1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q13283-G3BP1_HUMAN
    Recommended name:
    Ras GTPase-activating protein-binding protein 1
    Protein Accession:
    Q13283
    Secondary Accessions:
    • Q5HYE9

    Protein attributes for G3BP1 Gene

    Size:
    466 amino acids
    Molecular mass:
    52164 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Homodimer and oligomer (PubMed:12642610, PubMed:24324649). Component of a TAU mRNP complex, at least composed of IGF2BP1, ELAVL4 and G3BP1 (By similarity). Binds to the SH3 domain of Ras GTPase-activating protein (RASA1) in proliferating cells (By similarity). No interaction in quiescent cells (By similarity). Interacts (via NTF2-like domain) with USP10 (PubMed:11439350, PubMed:23279204). Interacts with RPTOR and SPAG5; this complex is increased by oxidative stress (PubMed:23953116). Interacts with ATXN2L (PubMed:23209657). Interacts with STYXL1 (PubMed:20180778). Interacts with CGAS (via N-terminus); this interaction promotes the DNA-binding and activation of CGAS (PubMed:30510222). Interacts (via C-terminus) with DDX58 (PubMed:30804210). Interacts (via NTF2-like domain) with CAPRIN1 (PubMed:17210633). Interacts with PABPC1 (PubMed:23279204).
    • (Microbial infection) Interacts with Semliki forest virus non-structural protein 3 (via C-terminus); this interaction inhibits the formation of host stress granules on viral mRNAs and the nsp3-G3BP1 complexes bind viral RNAs and probably orchestrate the assembly of viral replication complexes.
    • (Microbial infection) Interacts with Chikungunya virus non-structural protein 3 (via C-terminus); this interaction inhibits the formation of host stress granules on viral mRNAs and the nsp3-G3BP1 complexes bind viral RNAs and probably orchestrate the assembly of viral replication complexes.
    • (Microbial infection) Interacts with Sindbis virus non-structural protein 3 (via C-terminus); this interaction inhibits the formation of host stress granules on viral mRNAs and the nsp3-G3BP1 complexes bind viral RNAs and probably orchestrate the assembly of viral replication complexes.

    Three dimensional structures from OCA and Proteopedia for G3BP1 Gene

    Alternative splice isoforms for G3BP1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for G3BP1 Gene

Selected DME Specific Peptides for G3BP1 Gene

Q13283:
  • QEDLRTFSWASVTSKNLPPSGAVPVTG
  • PPHVVKVPASQPRPESKP
  • VRLNVEEKKTRAAREGDRRDNRLRGPGGPRGG
  • QRPQRDQRVREQRIN
  • PPQRGPRP
  • GNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFR

Post-translational modifications for G3BP1 Gene

  • (Microbial infection) Cleaved by human enterovirus 71; this cleavage induces the disassembly of cytoplasmic stress granules (PubMed:30006004). Cleaved by Foot-and-mouth disease virus; this cleavage suppresses the formation of cytoplasmic stress granules (PubMed:30404792).
  • Phosphorylated exclusively on serine residues. Hyperphosphorylated in quiescent fibroblasts. Hypophosphorylation leads to a decrease in endoribonuclease activity (By similarity). RASA1-dependent phosphorylation of Ser-149 induces a conformational change that prevents self-association. Dephosphorylation after HRAS activation is required for stress granule assembly. Ser-149 phosphorylation induces partial nuclear localization.
  • Arg-435 is dimethylated, probably to asymmetric dimethylarginine.
  • Ubiquitination at Lys36, Lys50, Lys59, Lys64, Lys76, Lys123, and Lys376
  • Modification sites at PhosphoSitePlus

Domains & Families for G3BP1 Gene

Gene Families for G3BP1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for G3BP1 Gene

Blocks:
  • RNA-binding region RNP-1 (RNA recognition motif)
  • Nuclear transport factor 2 (NTF2)
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for G3BP1 Gene

GenScript: Design optimal peptide antigens:
  • GAP SH3 domain-binding protein 1 (G3BP1_HUMAN)
  • GTPase activating protein (SH3 domain) binding protein 1 (Q32P45_HUMAN)
  • G3BP protein (Q6FI03_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q13283

UniProtKB/Swiss-Prot:

G3BP1_HUMAN :
  • The NTF2 domain mediates multimerization.
Domain:
  • The NTF2 domain mediates multimerization.
genes like me logo Genes that share domains with G3BP1: view

Function for G3BP1 Gene

Molecular function for G3BP1 Gene

UniProtKB/Swiss-Prot Function:
ATP- and magnesium-dependent helicase that plays an essential role in innate immunity (PubMed:30510222). Participates in the DNA-triggered cGAS/STING pathway by promoting the DNA binding and activation of CGAS. Enhances also DDX58-induced type I interferon production probably by helping DDX58 at sensing pathogenic RNA (PubMed:30804210). In addition, plays an essential role in stress granule formation (PubMed:12642610, PubMed:20180778, PubMed:23279204). Unwinds preferentially partial DNA and RNA duplexes having a 17 bp annealed portion and either a hanging 3' tail or hanging tails at both 5'- and 3'-ends (PubMed:9889278). Unwinds DNA/DNA, RNA/DNA, and RNA/RNA substrates with comparable efficiency (PubMed:9889278). Acts unidirectionally by moving in the 5' to 3' direction along the bound single-stranded DNA (PubMed:9889278). Phosphorylation-dependent sequence-specific endoribonuclease in vitro (PubMed:11604510). Cleaves exclusively between cytosine and adenine and cleaves MYC mRNA preferentially at the 3'-UTR (PubMed:11604510).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; EC=3.6.4.12; Evidence=. ;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; EC=3.6.4.13; Evidence=. ;.

Enzyme Numbers (IUBMB) for G3BP1 Gene

Phenotypes From GWAS Catalog for G3BP1 Gene

Gene Ontology (GO) - Molecular Function for G3BP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003676 nucleic acid binding IEA --
GO:0003677 DNA binding IEA --
GO:0003678 DNA helicase activity IEA,TAS --
GO:0003723 RNA binding HDA,IEA 22658674
GO:0003724 RNA helicase activity TAS,IEA --
genes like me logo Genes that share ontologies with G3BP1: view
genes like me logo Genes that share phenotypes with G3BP1: view

Animal Models for G3BP1 Gene

MGI Knock Outs for G3BP1:
  • G3bp1 G3bp1<tm1Tazi>
  • G3bp1 G3bp1<tm1b(KOMP)Wtsi>

Animal Model Products

CRISPR Products

miRNA for G3BP1 Gene

miRTarBase miRNAs that target G3BP1

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for G3BP1

Clone Products

  • Addgene plasmids for G3BP1

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for G3BP1 Gene

Localization for G3BP1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for G3BP1 Gene

Cytoplasm, cytosol. Perikaryon. Cytoplasm, Stress granule. Nucleus. Note=Cytoplasmic in proliferating cells (PubMed:11604510). Cytosolic and partially nuclear in resting cells (PubMed:11604510). Recruited to stress granules in response to arsenite treatment (PubMed:12642610, PubMed:20180778). The unphosphorylated form is recruited to stress granules (PubMed:12642610). HRAS signaling contributes to this process by regulating G3BP dephosphorylation (PubMed:12642610). {ECO:0000269 PubMed:11604510, ECO:0000269 PubMed:12642610, ECO:0000269 PubMed:20180778}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for G3BP1 gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 2
extracellular 2
cytoskeleton 2
mitochondrion 2
endoplasmic reticulum 2
endosome 2
peroxisome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for G3BP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,TAS --
GO:0005737 cytoplasm IEA,IDA 30510222
GO:0005829 cytosol IDA,IBA 20180778
GO:0005925 focal adhesion HDA 21423176
GO:0010494 cytoplasmic stress granule ISS --
genes like me logo Genes that share ontologies with G3BP1: view

Pathways & Interactions for G3BP1 Gene

PathCards logo

SuperPathways for G3BP1 Gene

No Data Available

Gene Ontology (GO) - Biological Process for G3BP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002376 immune system process IEA --
GO:0007265 Ras protein signal transduction TAS 8649363
GO:0016032 viral process IEA --
GO:0032508 DNA duplex unwinding IEA --
GO:0032606 type I interferon production IMP 30510222
genes like me logo Genes that share ontologies with G3BP1: view

No data available for Pathways by source and SIGNOR curated interactions for G3BP1 Gene

Drugs & Compounds for G3BP1 Gene

(7) Drugs for G3BP1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Magnesium Approved, Experimental, Investigational Pharma 0
Phenylephrine Approved Pharma Full agonist, Agonist 576
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0

(1) Additional Compounds for G3BP1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor 58-64-0
genes like me logo Genes that share compounds with G3BP1: view

Transcripts for G3BP1 Gene

mRNA/cDNA for G3BP1 Gene

2 REFSEQ mRNAs :
19 NCBI additional mRNA sequence :
14 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for G3BP1

Clone Products

  • Addgene plasmids for G3BP1

Alternative Splicing Database (ASD) splice patterns (SP) for G3BP1 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3a · 3b · 3c · 3d ^ 4a · 4b ^ 5a · 5b · 5c ^ 6 ^ 7 ^ 8 ^ 9a · 9b · 9c ^ 10 ^ 11a · 11b ^ 12 ^ 13 ^ 14a · 14b
SP1: - - -
SP2: - - - -
SP3: - - - - -
SP4: - - - - - - - - - - - - - - - -
SP5: - - -
SP6: - -
SP7: -
SP8: - -

Relevant External Links for G3BP1 Gene

GeneLoc Exon Structure for
G3BP1

Expression for G3BP1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for G3BP1 Gene

Protein differential expression in normal tissues from HIPED for G3BP1 Gene

This gene is overexpressed in Nasal epithelium (7.7) and Lung (7.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for G3BP1 Gene



Protein tissue co-expression partners for G3BP1 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for G3BP1

SOURCE GeneReport for Unigene cluster for G3BP1 Gene:

Hs.587054

mRNA Expression by UniProt/SwissProt for G3BP1 Gene:

Q13283-G3BP1_HUMAN
Tissue specificity: Ubiquitous.

Evidence on tissue expression from TISSUES for G3BP1 Gene

  • Nervous system(4.7)
  • Blood(4.5)
  • Liver(4.4)
  • Lung(3)
  • Skin(2.9)
  • Kidney(2.7)
  • Lymph node(2)
genes like me logo Genes that share expression patterns with G3BP1: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for G3BP1 Gene

Orthologs for G3BP1 Gene

This gene was present in the common ancestor of animals.

Orthologs for G3BP1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia G3BP1 31 30
  • 99.79 (n)
OneToOne
cow
(Bos Taurus)
Mammalia G3BP 31
  • 97 (a)
OneToOne
G3BP1 30
  • 91.68 (n)
dog
(Canis familiaris)
Mammalia G3BP1 31 30
  • 93.05 (n)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia -- 31
  • 88 (a)
OneToMany
-- 31
  • 86 (a)
OneToMany
-- 31
  • 80 (a)
OneToMany
rat
(Rattus norvegicus)
Mammalia G3bp1 30
  • 86.71 (n)
mouse
(Mus musculus)
Mammalia G3bp1 17 31 30
  • 86.49 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia G3BP1 31
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves G3BP1 31 30
  • 80.53 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia G3BP1 31
  • 82 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia g3bp1 30
  • 72.4 (n)
African clawed frog
(Xenopus laevis)
Amphibia g3bp-prov 30
zebrafish
(Danio rerio)
Actinopterygii g3bp1 31 30
  • 64.43 (n)
OneToOne
wufj17h05 30
fruit fly
(Drosophila melanogaster)
Insecta rin 31
  • 23 (a)
OneToMany
Species where no ortholog for G3BP1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for G3BP1 Gene

ENSEMBL:
Gene Tree for G3BP1 (if available)
TreeFam:
Gene Tree for G3BP1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for G3BP1: view image

Paralogs for G3BP1 Gene

Paralogs for G3BP1 Gene

(5) SIMAP similar genes for G3BP1 Gene using alignment to 9 proteins:

  • G3BP1_HUMAN
  • E5RH00_HUMAN
  • E5RH42_HUMAN
  • E5RI46_HUMAN
  • E5RIF8_HUMAN
  • E5RIZ6_HUMAN
  • E5RJU8_HUMAN
  • F5H4D6_HUMAN
  • Q32P45_HUMAN

Pseudogenes.org Pseudogenes for G3BP1 Gene

genes like me logo Genes that share paralogs with G3BP1: view

Variants for G3BP1 Gene

Additional dbSNP identifiers (rs#s) for G3BP1 Gene

Structural Variations from Database of Genomic Variants (DGV) for G3BP1 Gene

Variant ID Type Subtype PubMed ID
esv3417276 CNV insertion 20981092
nsv5070 CNV insertion 18451855
nsv980745 CNV duplication 23825009

Variation tolerance for G3BP1 Gene

Residual Variation Intolerance Score: 12.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.07; 21.90% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for G3BP1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
G3BP1

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for G3BP1 Gene

Disorders for G3BP1 Gene

MalaCards: The human disease database

(5) MalaCards diseases for G3BP1 Gene - From: LncRNADisease, DISEASES, and GeneCards

Disorder Aliases PubMed IDs
astrocytoma
  • astrocytic tumor
chikungunya
  • chikungunya fever
mouth disease
  • mouth disorders
oral mucosa leukoplakia
  • leukoplakia, oral
lung sarcoma
  • pulmonary sarcoma
- elite association - COSMIC cancer census association via MalaCards
Search G3BP1 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for G3BP1

genes like me logo Genes that share disorders with G3BP1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for G3BP1 Gene

Publications for G3BP1 Gene

  1. Human DNA helicase VIII: a DNA and RNA helicase corresponding to the G3BP protein, an element of the ras transduction pathway. (PMID: 9889278) Costa M … Falaschi A (Nucleic acids research 1999) 2 3 4 23 54
  2. A Ras-GTPase-activating protein SH3-domain-binding protein. (PMID: 8649363) Parker F … Tocque B (Molecular and cellular biology 1996) 2 3 4 23 54
  3. The pseudophosphatase MK-STYX interacts with G3BP and decreases stress granule formation. (PMID: 20180778) Hinton SD … Tonks NK (The Biochemical journal 2010) 3 4 23 54
  4. The RasGAP-associated endoribonuclease G3BP assembles stress granules. (PMID: 12642610) Tourrière H … Tazi J (The Journal of cell biology 2003) 3 4 23 54
  5. Ras-GAP SH3 domain binding protein (G3BP) is a modulator of USP10, a novel human ubiquitin specific protease. (PMID: 11439350) Soncini C … Draetta G (Oncogene 2001) 3 4 23 54

Products for G3BP1 Gene

Sources for G3BP1 Gene