The protein encoded by this gene belongs to the glycosyltransferase family. It is localized to the golgi, and catalyzes the last step in the biosynthesis of Lewis X (LeX) antigen, the addition of a fucose to precursor polysaccharides. This protein is one of the few fucosyltransferases that synthesizes the LeX oligosaccharide (CD15) expressed in the organ buds progressing in mes... See more...

Aliases for FUT9 Gene

Aliases for FUT9 Gene

  • Fucosyltransferase 9 2 3 4 5
  • Fucosyltransferase 9 (Alpha (1,3) Fucosyltransferase) 2 3
  • Galactoside 3-L-Fucosyltransferase 3 4
  • Alpha-(1,3)-Fucosyltransferase 9 3 4
  • Fucosyltransferase IX 3 4
  • FucT-IX 3 4
  • Fuc-TIX 3 4
  • Alpha (1,3) Fucosyltransferase 2
  • EC 2.4.1.65 52
  • EC 2.4.1.- 4
  • EC 2.4.1 52

External Ids for FUT9 Gene

Previous GeneCards Identifiers for FUT9 Gene

  • GC06P096332
  • GC06P096480
  • GC06P096509
  • GC06P096570
  • GC06P096463
  • GC06P093896

Summaries for FUT9 Gene

Entrez Gene Summary for FUT9 Gene

  • The protein encoded by this gene belongs to the glycosyltransferase family. It is localized to the golgi, and catalyzes the last step in the biosynthesis of Lewis X (LeX) antigen, the addition of a fucose to precursor polysaccharides. This protein is one of the few fucosyltransferases that synthesizes the LeX oligosaccharide (CD15) expressed in the organ buds progressing in mesenchyma during embryogenesis. It is also responsible for the expression of CD15 in mature granulocytes. A common haplotype of this gene has also been associated with susceptibility to placental malaria infection. [provided by RefSeq, Nov 2011]

GeneCards Summary for FUT9 Gene

FUT9 (Fucosyltransferase 9) is a Protein Coding gene. Diseases associated with FUT9 include Malaria and Walker-Warburg Syndrome. Among its related pathways are Globo Sphingolipid Metabolism and Glycosphingolipid biosynthesis - lacto and neolacto series. Gene Ontology (GO) annotations related to this gene include fucosyltransferase activity and alpha-(1->3)-fucosyltransferase activity. An important paralog of this gene is FUT4.

UniProtKB/Swiss-Prot Summary for FUT9 Gene

  • Transfers a fucose to lacto-N-neotetraose but not to either alpha2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. Can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides.

Gene Wiki entry for FUT9 Gene

Additional gene information for FUT9 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for FUT9 Gene

Genomics for FUT9 Gene

GeneHancer (GH) Regulatory Elements for FUT9 Gene

Promoters and enhancers for FUT9 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH06J096014 Promoter/Enhancer 1.7 EPDnew Ensembl ENCODE CraniofacialAtlas 500.7 +0.3 332 3.4 CTCF POLR2A MYC SMC3 MXI1 YY1 PHF8 CBX2 CHD1 TAF1 FUT9 ENSG00000287578 lnc-FUT9-1 FHL5 LOC105377905
GH06J096096 Promoter 0.3 EPDnew 507.1 +80.6 80593 0.1 FUT9 piR-56341-200 lnc-UFL1-2
GH06J096104 Enhancer 0.5 Ensembl 11.4 +89.7 89678 2.5 ZNF217 GATA3 DPF2 SMARCE1 FOS FOXA1 FUT9 piR-56341-200 lnc-UFL1-2
GH06J096162 Enhancer 0.7 Ensembl ENCODE 7.2 +147.3 147332 3 TEAD4 POLR2A HDAC2 SRF TCF12 JUNB TAF1 EP300 SP1 POU5F1 FUT9 lnc-UFL1-2 piR-56341-200
GH06J096155 Enhancer 0.5 ENCODE 7.3 +140.6 140633 1.6 GATA3 PRDM1 TBX21 ATF7 GATA2 ZNF680 EBF1 FUT9 lnc-UFL1-2 piR-56341-200
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around FUT9 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for FUT9

Top Transcription factor binding sites by QIAGEN in the FUT9 gene promoter:
  • Arnt
  • E47
  • FOXD3
  • HNF-1
  • HNF-1A
  • POU2F1
  • POU2F1a

Genomic Locations for FUT9 Gene

Genomic Locations for FUT9 Gene
chr6:96,015,969-96,215,612
(GRCh38/hg38)
Size:
199,644 bases
Orientation:
Plus strand
chr6:96,463,845-96,663,488
(GRCh37/hg19)
Size:
199,644 bases
Orientation:
Plus strand

Genomic View for FUT9 Gene

Genes around FUT9 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FUT9 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FUT9 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for FUT9 Gene

Proteins for FUT9 Gene

  • Protein details for FUT9 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9Y231-FUT9_HUMAN
    Recommended name:
    Alpha-(1,3)-fucosyltransferase 9
    Protein Accession:
    Q9Y231
    Secondary Accessions:
    • Q5T0W4

    Protein attributes for FUT9 Gene

    Size:
    359 amino acids
    Molecular mass:
    42071 Da
    Quaternary structure:
    No Data Available

neXtProt entry for FUT9 Gene

Selected DME Specific Peptides for FUT9 Gene

Q9Y231:
  • FSPMESASSVLKMKNFFS
  • FYLSFENS
  • VPVVLGP
  • KEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFG
  • FNETTIL

Post-translational modifications for FUT9 Gene

  • Glycosylation at Asn62, Asn101, and Asn153
  • Modification sites at PhosphoSitePlus

Other Protein References for FUT9 Gene

Domains & Families for FUT9 Gene

Gene Families for FUT9 Gene

HGNC:
Human Protein Atlas (HPA):
  • Predicted membrane proteins

Protein Domains for FUT9 Gene

Blocks:
  • Glycosyl transferase, family 10
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for FUT9 Gene

GenScript: Design optimal peptide antigens:
  • Galactoside 3-L-fucosyltransferase (FUT9_HUMAN)
  • cDNA, FLJ95882, Homo sapiens fucosyltransferase 9 (alpha (1,3) fucosyltransferase) (FUT9), mRNA (Q5Q0U2_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9Y231

UniProtKB/Swiss-Prot:

FUT9_HUMAN :
  • Belongs to the glycosyltransferase 10 family.
Family:
  • Belongs to the glycosyltransferase 10 family.
genes like me logo Genes that share domains with FUT9: view

Function for FUT9 Gene

Molecular function for FUT9 Gene

UniProtKB/Swiss-Prot Function:
Transfers a fucose to lacto-N-neotetraose but not to either alpha2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. Can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides.
GENATLAS Biochemistry:
fucosyltransferase 9,alpha (1.3) fucosyltransferase,abundantly expressed in brain and stomach,also detected in spleen and peripheral blood leukocytes,mouse Fuc-TIX ortholog,catalyzing the last step of Lewis X synthesis

Enzyme Numbers (IUBMB) for FUT9 Gene

Phenotypes From GWAS Catalog for FUT9 Gene

Gene Ontology (GO) - Molecular Function for FUT9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0008417 fucosyltransferase activity TAS 10386598
GO:0016740 transferase activity IEA --
GO:0016757 transferase activity, transferring glycosyl groups IEA --
GO:0046920 alpha-(1->3)-fucosyltransferase activity IEA,TAS 11698403
genes like me logo Genes that share ontologies with FUT9: view
genes like me logo Genes that share phenotypes with FUT9: view

Animal Models for FUT9 Gene

MGI Knock Outs for FUT9:
  • Fut9 Fut9<tm1Nari>

Animal Model Products

Clone Products

  • Addgene plasmids for FUT9

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for FUT9 Gene

Localization for FUT9 Gene

Subcellular locations from UniProtKB/Swiss-Prot for FUT9 Gene

Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Membrane-bound form in trans cisternae of Golgi. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for FUT9 gene
Compartment Confidence
golgi apparatus 5
extracellular 2
endoplasmic reticulum 2
plasma membrane 1
cytoskeleton 1
mitochondrion 1
nucleus 1
cytosol 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytokinetic bridge (2)
  • Cytosol (2)
  • Microtubules (2)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for FUT9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005794 Golgi apparatus TAS 11698403
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
GO:0032580 Golgi cisterna membrane IEA --
genes like me logo Genes that share ontologies with FUT9: view

Pathways & Interactions for FUT9 Gene

genes like me logo Genes that share pathways with FUT9: view

UniProtKB/Swiss-Prot Q9Y231-FUT9_HUMAN

  • Pathway: Protein modification; protein glycosylation.

Gene Ontology (GO) - Biological Process for FUT9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005975 carbohydrate metabolic process TAS 10386598
GO:0006486 protein glycosylation TAS 11698403
GO:0007399 nervous system development IEA --
GO:0036065 fucosylation IBA 21873635
GO:0042355 L-fucose catabolic process NAS 11698403
genes like me logo Genes that share ontologies with FUT9: view

No data available for SIGNOR curated interactions for FUT9 Gene

Drugs & Compounds for FUT9 Gene

(1) Drugs for FUT9 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Guanosine diphosphate Experimental Pharma 0

(3) Additional Compounds for FUT9 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
GDP-L-fucose
  • (6-Deoxy-beta-L-galactopyranosyl) ester
  • GDP Fucose
  • GDP-beta-L-Fucose
  • Guanosine diphosphate fucose
  • Guanosine diphosphofucose
15839-70-0
Lacto-N-tetraose
  • lacto-N-neo-Tetraose
  • lacto-N-Neotetraose
  • lacto-N-Tetraose
  • LNNT
  • O-beta-D-Galactopyranosyl-(1->4)-O-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1->3)-O-beta-D-galactopyranosyl-(1->4)- D-glucose
13007-32-4, 14116-68-8
genes like me logo Genes that share compounds with FUT9: view

Transcripts for FUT9 Gene

mRNA/cDNA for FUT9 Gene

1 REFSEQ mRNAs :
12 NCBI additional mRNA sequence :
2 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Clone Products

  • Addgene plasmids for FUT9

Alternative Splicing Database (ASD) splice patterns (SP) for FUT9 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5
SP1: - -
SP2:

Relevant External Links for FUT9 Gene

GeneLoc Exon Structure for
FUT9

Expression for FUT9 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for FUT9 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for FUT9 Gene

This gene is overexpressed in Brain - Cerebellum (x8.0), Brain - Cerebellar Hemisphere (x6.5), Brain - Cortex (x4.5), and Brain - Frontal Cortex (BA9) (x4.2).

Protein differential expression in normal tissues from HIPED for FUT9 Gene

This gene is overexpressed in Serum (66.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for FUT9 Gene



Protein tissue co-expression partners for FUT9 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for FUT9

SOURCE GeneReport for Unigene cluster for FUT9 Gene:

Hs.49117

mRNA Expression by UniProt/SwissProt for FUT9 Gene:

Q9Y231-FUT9_HUMAN
Tissue specificity: Strongly expressed in forebrain and stomach, lower expression in spleen and peripheral blood leukocytes, and no expression in small intestine, colon, liver, lung, kidney, adrenal cortex or uterus.

Evidence on tissue expression from TISSUES for FUT9 Gene

  • Nervous system(4.7)
genes like me logo Genes that share expression patterns with FUT9: view

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for FUT9 Gene

Orthologs for FUT9 Gene

This gene was present in the common ancestor of animals.

Orthologs for FUT9 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia FUT9 31 30
  • 99.35 (n)
OneToOne
dog
(Canis familiaris)
Mammalia FUT9 31 30
  • 94.71 (n)
OneToOne
cow
(Bos Taurus)
Mammalia FUT9 31 30
  • 93.31 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Fut9 17 31 30
  • 91.46 (n)
rat
(Rattus norvegicus)
Mammalia Fut9 30
  • 91.27 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia FUT9 31
  • 91 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia FUT9 31
  • 90 (a)
OneToOne
chicken
(Gallus gallus)
Aves CFUC-TIX 31
  • 84 (a)
OneToOne
FUT9 30
  • 83.01 (n)
lizard
(Anolis carolinensis)
Reptilia FUT9 31
  • 86 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia fut9 30
  • 75.77 (n)
zebrafish
(Danio rerio)
Actinopterygii fut9a 31 30
  • 62.11 (n)
OneToOne
-- 30
fruit fly
(Drosophila melanogaster)
Insecta FucTA 31
  • 21 (a)
OneToOne
worm
(Caenorhabditis elegans)
Secernentea fut-4 31
  • 23 (a)
OneToMany
fut-5 31
  • 23 (a)
OneToMany
fut-6 31
  • 23 (a)
OneToMany
fut-3 31
  • 20 (a)
OneToMany
fut-1 31
  • 19 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 36 (a)
OneToMany
-- 31
  • 31 (a)
OneToMany
-- 31
  • 27 (a)
OneToMany
Species where no ortholog for FUT9 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for FUT9 Gene

ENSEMBL:
Gene Tree for FUT9 (if available)
TreeFam:
Gene Tree for FUT9 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for FUT9: view image

Paralogs for FUT9 Gene

Paralogs for FUT9 Gene

(5) SIMAP similar genes for FUT9 Gene using alignment to 3 proteins:

  • FUT9_HUMAN
  • B4DEW1_HUMAN
  • Q5Q0U2_HUMAN
genes like me logo Genes that share paralogs with FUT9: view

Variants for FUT9 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for FUT9 Gene

SNP ID Clinical significance and condition Chr 06 pos Variation AA Info Type
rs3811069 - p.Thr237Ala
rs9986564 - p.Trp358Gly

Additional dbSNP identifiers (rs#s) for FUT9 Gene

Structural Variations from Database of Genomic Variants (DGV) for FUT9 Gene

Variant ID Type Subtype PubMed ID
esv1046648 CNV insertion 17803354
esv1667871 CNV insertion 17803354
esv2422431 CNV duplication 17116639
esv2669302 CNV deletion 23128226
esv2675747 CNV deletion 23128226
esv2732455 CNV deletion 23290073
esv2732456 CNV deletion 23290073
esv2732457 CNV deletion 23290073
esv2732458 CNV deletion 23290073
esv3356638 CNV insertion 20981092
esv3610064 CNV loss 21293372
esv3610068 CNV loss 21293372
esv3610070 CNV loss 21293372
nsv1027905 CNV gain 25217958
nsv1124105 CNV deletion 24896259
nsv1125883 CNV tandem duplication 24896259
nsv1132001 CNV deletion 24896259
nsv1139868 CNV duplication 24896259
nsv1153643 CNV deletion 26484159
nsv1161437 CNV deletion 26073780
nsv349387 CNV deletion 16902084
nsv349975 CNV deletion 16902084
nsv528247 CNV gain 19592680
nsv604248 CNV loss 21841781
nsv823781 CNV gain 20364138
nsv823782 CNV gain 20364138
nsv830738 CNV loss 17160897

Variation tolerance for FUT9 Gene

Residual Variation Intolerance Score: 25.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.44; 9.60% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for FUT9 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
FUT9

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for FUT9 Gene

Disorders for FUT9 Gene

MalaCards: The human disease database

(2) MalaCards diseases for FUT9 Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
malaria
  • malaria, susceptibility to
walker-warburg syndrome
  • hydrocephalus, agyria, and retinal dysplasia
- elite association - COSMIC cancer census association via MalaCards
Search FUT9 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for FUT9

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with FUT9: view

No data available for UniProtKB/Swiss-Prot and Genatlas for FUT9 Gene

Publications for FUT9 Gene

  1. Alpha1,3-fucosyltransferase IX (Fuc-TIX) is very highly conserved between human and mouse; molecular cloning, characterization and tissue distribution of human Fuc-TIX. (PMID: 10386598) Kaneko M … Narimatsu H (FEBS letters 1999) 2 3 4 23 54
  2. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 41 54
  3. Human fucosyltransferase IX: specificity towards N-linked glycoproteins and relevance of the cytoplasmic domain in intra-Golgi localization. (PMID: 18395013) Brito C … Costa J (Biochimie 2008) 3 23 54
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 54
  5. The DNA sequence and analysis of human chromosome 6. (PMID: 14574404) Mungall AJ … Beck S (Nature 2003) 3 4 54

Products for FUT9 Gene

Sources for FUT9 Gene