Aliases for FUT8 Gene
Aliases for FUT8 Gene
- Fucosyltransferase 8 2 3 4 5
- GDP-L-Fuc:N-Acetyl-Beta-D-Glucosaminide Alpha1,6-Fucosyltransferase 3 4
- Fucosyltransferase 8 (Alpha (1,6) Fucosyltransferase) 2 3
- GDP-Fucose--Glycoprotein Fucosyltransferase 3 4
- Glycoprotein 6-Alpha-L-Fucosyltransferase 3 4
- Alpha1-6FucT 3 4
- EC 2.4.1.68 4 56
- Alpha (1,6) Fucosyltransferase 2
- Alpha-(1,6)-Fucosyltransferase 3
External Ids for FUT8 Gene
- HGNC: 4019
- Entrez Gene: 2530
- Ensembl: ENSG00000033170
- OMIM: 602589
- UniProtKB: Q9BYC5
Previous GeneCards Identifiers for FUT8 Gene
- GC14P063206
- GC14P059672
- GC14P063867
- GC14P064947
- GC14P065877
- GC14P046046
Summaries for FUT8 Gene
-
This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2011]
GeneCards Summary for FUT8 Gene
FUT8 (Fucosyltransferase 8) is a Protein Coding gene. Diseases associated with FUT8 include Pancreatic Acinar Cell Adenocarcinoma and Smoldering Myeloma. Among its related pathways are Metabolism of proteins and Transport to the Golgi and subsequent modification. Gene Ontology (GO) annotations related to this gene include SH3 domain binding and glycoprotein 6-alpha-L-fucosyltransferase activity.
UniProtKB/Swiss-Prot for FUT8 Gene
-
Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.
Additional gene information for FUT8 Gene
- Monarch Initiative
- Search for FUT8 at DataMed
- Search for FUT8 at HumanCyc
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for FUT8 Gene
Genomics for FUT8 Gene
GeneHancer (GH) Regulatory Elements for FUT8 Gene
Promoters and enhancers for FUT8 Gene
| GeneHancer (GH) Identifier | GH Type | GH Score |
GH Sources | Gene Association Score | Total Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites |
Gene Targets |
|---|---|---|---|---|---|---|---|---|---|---|
| GH14I065410 | Promoter/Enhancer | 2 | EPDnew Ensembl ENCODE | 554.8 | +2.3 | 2338 | 4 | PKNOX1 FOXA2 MLX ARID4B SIN3A DMAP1 ZNF2 YY1 ZNF766 ZNF207 | FUT8 FUT8-AS1 LOC102723809 RPL21P8 MIR625 GC14M065468 | |
| GH14I065592 | Promoter | 0.5 | EPDnew | 550.1 | +181.8 | 181811 | 0.1 | FUT8 MIR625 RPL21P8 EIF1AXP2 GC14M065746 | ||
| GH14I065224 | Enhancer | 1.6 | FANTOM5 Ensembl ENCODE dbSUPER | 15.5 | -182.0 | -181973 | 8.4 | PKNOX1 CLOCK FOXA2 ARID4B NEUROD1 SIN3A DMAP1 ZBTB7B IRF4 YY1 | FUT8 LINC02324 LOC100420096 GC14M065218 | |
| GH14I065430 | Enhancer | 0.9 | Ensembl ENCODE | 15.8 | +22.5 | 22475 | 4.2 | HDAC1 MEIS2 PKNOX1 TEAD4 TAL1 EBF1 GATA3 GATA2 VEZF1 ZSCAN29 | FUT8 RPL21P8 MIR625 FUT8-AS1 GC14M065468 | |
| GH14I065281 | Enhancer | 1.2 | FANTOM5 Ensembl ENCODE dbSUPER | 11.5 | -127.9 | -127880 | 2.3 | HDGF SP1 PKNOX1 POLR2A TARDBP | FUT8 FNTB PTBP1P GC14M065292 ENSG00000258760 |
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around FUT8 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Locations for FUT8 Gene
Genomic Locations for FUT8 Gene
- chr14:65,410,592-65,744,121
- (GRCh38/hg38)
- Size:
- 333,530 bases
- Orientation:
- Plus strand
- chr14:65,877,310-66,210,839
- (GRCh37/hg19)
Genomic View for FUT8 Gene
Genes around FUT8 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 14q23.3 by Ensembl
- 14q23.3 by Entrez Gene
- 14q23.3 by HGNC
FUT8 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for FUT8 Gene
Proteins for FUT8 Gene
-
Protein details for FUT8 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9BYC5-FUT8_HUMAN
- Recommended name:
- Alpha-(1,6)-fucosyltransferase
- Protein Accession:
- Q9BYC5
- B4DFS7
- G3V5N0
- O00235
- Q8IUA5
- Q9BYC6
- Q9P2U5
- Q9P2U6
Protein attributes for FUT8 Gene
- Size:
- 575 amino acids
- Molecular mass:
- 66516 Da
- Quaternary structure:
- No Data Available
Protein Expression for FUT8 Gene
Selected DME Specific Peptides for FUT8 Gene
- Q9BYC5:
-
- LEGNELQRHADE
- GGQNAHN
- TGHWSGE
- LRRRIENGAKELWFFLQSELKKLK
- ETCTDRSG
- LLKEAKTKY
- EAAFHPIEEY
- EIPMEPGDIIGVAGNHWDGY
- EPGDIIGVAGNHWDGYSKG
- WTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHS
- KAKEQIE
- PRPPYLPLAVPEDLA
- RVYLATDDP
- MTDLYYLSQTDGAGDWRE
- WRYATGGWETVF
- NKGCGYGCQLHHVVYCF
- HGDPAVWWVSQFVKYLIRPQPWLEKEIEE
Post-translational modifications for FUT8 Gene
- Tyrosine phosphorylated by PKDCC/VLK.
- Glycosylation at isoforms=3, 4564
- Modification sites at PhosphoSitePlus
Other Protein References for FUT8 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for FUT8 (Fucosyltransferase 8/FUT8)
-
Custom Antibody ServicesOriGene Antibodies for FUT8
- Novus Biologicals Antibodies for FUT8
-
Abcam antibodies for FUT8
- Invitrogen Antibodies for FUT8
- Search GeneTex for Antibodies for FUT8
-
Santa Cruz Biotechnology (SCBT) Antibodies for FUT8
Protein Products
- R&D Systems Proteins and Enzymes for FUT8 (Fucosyltransferase 8/FUT8)
- Search Origene for MassSpec and Protein Over-expression Lysates for FUT8
- Origene Custom Protein Services for FUT8
- Sino Biological Cell Lysates for FUT8
- Sino Biological Recombinant Proteins for FUT8
- antibodies-online: Search results for 11 available FUT8 Proteins ranked by validation data
- Compare Top FUT8 Proteins
-
Quality Products:
- Search GeneTex for Proteins for FUT8
-
Abcam proteins for FUT8
Assay Products
Domains & Families for FUT8 Gene
Gene Families for FUT8 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for FUT8 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for FUT8 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q9BYC5- Family:
-
- Belongs to the glycosyltransferase 23 family.
Function for FUT8 Gene
Molecular function for FUT8 Gene
- GENATLAS Biochemistry:
- fucosyltransferase,alpha (1,6),8,involved in the biosynthesis of asparagine-linked glycoprotein oligosaccharides
- UniProtKB/Swiss-Prot CatalyticActivity:
- GDP-beta-L-fucose + N(4)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->3)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->6))-beta-D-mannosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl)asparagine = GDP + N(4)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->3)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->6))-beta-D-mannosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->4)-(alpha-L-fucosyl-(1->6))-N-acetyl-beta-D-glucosaminyl)asparagine.
- UniProtKB/Swiss-Prot Function:
- Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.
Enzyme Numbers (IUBMB) for FUT8 Gene
Phenotypes From GWAS Catalog for FUT8 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0008424 | glycoprotein 6-alpha-L-fucosyltransferase activity | TAS | 11698403 |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0016757 | transferase activity, transferring glycosyl groups | IEA | -- |
| GO:0017124 | SH3 domain binding | IEA | -- |
| GO:0046921 | alpha-(1->6)-fucosyltransferase activity | IEA | -- |
Phenotypes for FUT8 Gene
- MGI mutant phenotypes for FUT8:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for FUT8:
Animal Models for FUT8 Gene
- MGI Knock Outs for FUT8:
-
- Fut8 tm1Nta
Animal Model Products
-
Taconic Biosciences Mouse Models for FUT8
- Cyagen custom Knockout/knockin (KOKI) mouse models for FUT8
-
-
ViGene Biosciences lentiviral particle packaged cDNA for FUT8 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for FUT8 gene
- Search ViGene Biosciences for FUT8
CRISPR Products
-
OriGene CRISPR knockouts for FUT8
- genomics-online: gRNA clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
-
Recommended
- Applied Biological Materials CRISPR for FUT8
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for FUT8
- GenScript: Design CRISPR guide RNA sequences for FUT8
miRNA for FUT8 Gene
- miRTarBase miRNAs that target FUT8
miRNA Products
- Search ViGene Biosciences for FUT8
Inhibitory RNA Products
- Origene shrna and RNAi products in human, mouse, rat for FUT8
- Browse OriGene Inhibitory RNA Products For FUT8
- genomics-online: shRNA clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
-
Recommended
-
ViGene Biosciences ready-to-package AAV shRNAs for FUT8 gene
Clone Products
- Sino Biological Human cDNA Clone for FUT8
- VectorBuilder custom plasmid, inducible vectors for FUT8
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for FUT8
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- genomics-online: cdna clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
-
Recommended
- orf clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
-
Recommended
- Applied Biological Materials Clones for FUT8
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for FUT8
-
ViGene Biosciences adenoviral particle packaged cDNA for FUT8 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for FUT8 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for FUT8 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for FUT8 Gene
Localization for FUT8 Gene
Subcellular locations from UniProtKB/Swiss-Prot for FUT8 Gene
- Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Membrane-bound form in trans cisternae of Golgi. {ECO:0000250}.
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| cytosol | 5 |
| golgi apparatus | 5 |
| endoplasmic reticulum | 2 |
| plasma membrane | 1 |
| peroxisome | 1 |
- Cytosol (4)
- Golgi apparatus (4)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000139 | Golgi membrane | TAS | -- |
| GO:0005794 | Golgi apparatus | NAS | 11698403 |
| GO:0005829 | cytosol | IDA | -- |
| GO:0016020 | membrane | HDA,IEA | 19946888 |
| GO:0016021 | integral component of membrane | IEA | -- |
Pathways & Interactions for FUT8 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Transport to the Golgi and subsequent modification | ||
| 2 | Metabolism of proteins | ||
| 3 | N-glycan antennae elongation in the medial/trans-Golgi | ||
| 4 | Keratan sulfate/keratin metabolism | ||
| 5 | Metabolism | ||
Pathways by source for FUT8 Gene
1 BioSystems pathway for FUT8 Gene
4 KEGG pathways for FUT8 Gene
UniProtKB/Swiss-Prot Q9BYC5-FUT8_HUMAN
- Pathway: Protein modification; protein glycosylation.
Interacting Proteins for FUT8 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0001701 | in utero embryonic development | NAS | 11698403 |
| GO:0006486 | protein glycosylation | IEA | -- |
| GO:0006487 | protein N-linked glycosylation | TAS | 9133635 |
| GO:0006491 | N-glycan processing | TAS | 11698403 |
| GO:0007179 | transforming growth factor beta receptor signaling pathway | IEA | -- |
No data available for SIGNOR curated interactions for FUT8 Gene
Drugs & Compounds for FUT8 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Guanosine diphosphate | Experimental | Pharma | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| GDP-L-fucose |
|
15839-70-0 |
|
Transcripts for FUT8 Gene
mRNA/cDNA for FUT8 Gene
- (11) REFSEQ mRNAs :
- (22) Additional mRNA sequences :
- (235) Selected AceView cDNA sequences:
- (15) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for FUT8 Gene
CRISPR Products
-
OriGene CRISPR knockouts for FUT8
- genomics-online: gRNA clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
-
Recommended
- Applied Biological Materials CRISPR for FUT8
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for FUT8
- GenScript: Design CRISPR guide RNA sequences for FUT8
miRNA Products
- Search ViGene Biosciences for FUT8
Inhibitory RNA Products
- Origene shrna and RNAi products in human, mouse, rat for FUT8
- Browse OriGene Inhibitory RNA Products For FUT8
- genomics-online: shRNA clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
-
Recommended
-
ViGene Biosciences ready-to-package AAV shRNAs for FUT8 gene
Clone Products
- Sino Biological Human cDNA Clone for FUT8
- VectorBuilder custom plasmid, inducible vectors for FUT8
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for FUT8
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- genomics-online: cdna clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
-
Recommended
- orf clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
-
Recommended
- Applied Biological Materials Clones for FUT8
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
| ExUns: | 1a | · | 1b | ^ | 2a | · | 2b | · | 2c | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6a | · | 6b | · | 6c | · | 6d | · | 6e | ^ | 7 | ^ | 8a | · | 8b | ^ | 9 | ^ | 10 | ^ | 11a | · | 11b | ^ | 12 | ^ | 13 | ^ | 14 | ^ | 15a | · | 15b |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||
| SP5: | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP9: |
Expression for FUT8 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
This gene is overexpressed in Nasal epithelium (36.1), Breast (12.4), and Bone (6.8).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for FUT8 Gene
NURSA nuclear receptor signaling pathways regulating expression of FUT8 Gene:
FUT8SOURCE GeneReport for Unigene cluster for FUT8 Gene:
Hs.597649Evidence on tissue expression from TISSUES for FUT8 Gene
- Nervous system(4.8)
- Lung(4.7)
- Liver(3.3)
- Pancreas(3)
- Eye(2.7)
- Stomach(2.5)
- Skin(2.3)
- Intestine(2.2)
Primer Products
-
OriGene qPCR primer pairs and template standards for FUT8
-
OriGene qPCR primer pairs for FUT8
- genomics-online: primer clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
-
Recommended
Gene Expression Assay Products
No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for FUT8 Gene
Orthologs for FUT8 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | FUT8 33 34 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | -- 34 |
|
OneToMany | |
| -- 34 |
|
OneToMany | |||
| dog (Canis familiaris) |
Mammalia | FUT8 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | FUT8 33 34 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | FUT8 34 |
|
OneToOne | |
| rat (Rattus norvegicus) |
Mammalia | Fut8 33 |
|
||
| mouse (Mus musculus) |
Mammalia | Fut8 33 16 34 |
|
||
| chicken (Gallus gallus) |
Aves | FUT8 33 34 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | FUT8 34 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | fut8 33 |
|
||
| Str.230 33 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | fut8-A 33 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | FUT8 (2 of 2) 34 |
|
OneToMany | |
| fut8a 33 34 |
|
||||
| Dr.5303 33 |
|
||||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP001888 33 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | FucT6 35 33 34 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | fut-8 33 34 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToOne | |
| sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.11077 33 |
|
- Species where no ortholog for FUT8 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for FUT8 Gene
No data available for Paralogs for FUT8 Gene
Variants for FUT8 Gene
| SNP ID | Clin | Chr 14 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs2229677 | benign, not specified | 65,561,728(+) | A/G | coding_sequence_variant, genic_upstream_transcript_variant, intron_variant, non_coding_transcript_variant, synonymous_variant | |
| rs35137471 | benign, not specified | 65,629,579(+) | G/A/T | coding_sequence_variant, genic_upstream_transcript_variant, non_coding_transcript_variant, synonymous_variant | |
| rs1000008276 | -- | 65,450,947(+) | C/A | genic_upstream_transcript_variant, intron_variant | |
| rs1000009430 | -- | 65,568,488(+) | A/T | genic_upstream_transcript_variant, intron_variant, upstream_transcript_variant | |
| rs1000017467 | -- | 65,710,603(+) | A/G/T | intron_variant |
Residual Variation Intolerance Score:
20.6% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
7.29;
81.33% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for FUT8 Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for FUT8 Gene
Disorders for FUT8 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| pancreatic acinar cell adenocarcinoma |
|
|
| smoldering myeloma |
|
|
Search FUT8 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for FUT8
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for FUT8 Gene
Publications for FUT8 Gene
- Crystal structure of mammalian alpha1,6-fucosyltransferase, FUT8. (PMID: 17172260) Ihara H … Taniguchi N (Glycobiology 2007) 3 4 22 58
- Genomic structure and promoter analysis of the human alpha1, 6-fucosyltransferase gene (FUT8). (PMID: 10814706) Yamaguchi Y … Taniguchi N (Glycobiology 2000) 3 4 22 58
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 44 58
- Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1α as a master regulator of plasma protein fucosylation. (PMID: 21203500) Lauc G … Rudan I (PLoS genetics 2010) 3 44 58
- Core fucosylation of E-cadherin enhances cell-cell adhesion in human colon carcinoma WiDr cells. (PMID: 19302290) Osumi D … Taniguchi N (Cancer science 2009) 3 22 58
Products for FUT8 Gene
- R&D Systems Antibodies for FUT8 (Fucosyltransferase 8/FUT8)
- R&D Systems Proteins and Enzymes for FUT8 (Fucosyltransferase 8/FUT8)
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for FUT8
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for FUT8
- Origene Custom Protein Services for FUT8
- Origene shrna and RNAi products in human, mouse, rat for FUT8
- Browse OriGene Inhibitory RNA Products For FUT8
- OriGene qPCR primer pairs and template standards for FUT8
- OriGene qPCR primer pairs for FUT8
- OriGene CRISPR knockouts for FUT8
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For FUT8
- GenScript: Next-day shipping of latest version cDNA ORF clones for FUT8 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for FUT8
- GenScript Custom Assay Services for FUT8
- GenScript Custom overexpressing Cell Line Services for FUT8
- GenScript: Design CRISPR guide RNA sequences for FUT8
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for FUT8
- Sino Biological Human cDNA Clone for FUT8
- Sino Biological Cell Lysates for FUT8
- Sino Biological Recombinant Proteins for FUT8
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for FUT8
- Novus Biologicals lysates and proteins for FUT8
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for FUT8
- Abcam proteins for FUT8
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Taconic Biosciences Mouse Models for FUT8
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for FUT8
- Cyagen custom Knockout/knockin (KOKI) mouse models for FUT8
- VectorBuilder custom plasmid, inducible vectors for FUT8
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for FUT8
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 58 available FUT8 Antibodies ranked by validation data
- Compare Top FUT8 Antibodies
- Quality Products:
- antibodies-online: Search results for 17 available FUT8 Elisa Kits ranked by validation data
- Compare Top FUT8 Elisa Kits
- antibodies-online: Search results for 11 available FUT8 Proteins ranked by validation data
- Compare Top FUT8 Proteins
- Quality Products:
- Search GeneTex for Antibodies for FUT8
- Search GeneTex for Proteins for FUT8
- ViGene Biosciences adenoviral particle packaged cDNA for FUT8 gene
- ViGene Biosciences lentiviral particle packaged cDNA for FUT8 gene
- ViGene Biosciences ready-to-package AAV shRNAs for FUT8 gene
- Search ViGene Biosciences for FUT8
- Santa Cruz Biotechnology (SCBT) Antibodies for FUT8
- Search Santa Cruz Biotechnology (SCBT) for FUT8 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for FUT8
- Horizon Cell Lines for FUT8
- genomics-online: cdna clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
- Recommended
- orf clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
- Recommended
- genomics-online: gRNA clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
- Recommended
- genomics-online: primer clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
- Recommended
- genomics-online: shRNA clones - Search results for 139 available FUT8 gene related products
- Overview of 139 available FUT8 gene related products
- Recommended
Sources for FUT8 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew
- (158) Applied Biosystems