FOLH1B Gene (Protein Coding)

Folate Hydrolase 1B

GC11P089638
GIFtS:
27
See more...

Aliases for FOLH1B Gene

Aliases for FOLH1B Gene

  • Folate Hydrolase 1B 2 3 5
  • Cell Growth-Inhibiting Gene 26 Protein 2 3 4
  • PSMAL 2 3 4
  • Putative N-Acetylated-Alpha-Linked Acidic Dipeptidase 3 4
  • Prostate-Specific Membrane Antigen-Like Protein 3 4
  • Putative Folate Hydrolase 1B 3 4
  • Folate Hydrolase 2 2 3
  • NAALADase 3 4
  • Prostate Specific Membrane Antigen Like Protein 2
  • N-Acetylated-Alpha-Linked-Acidic Dipeptidase 3
  • Glutamate Carboxypeptidase III 3
  • Folate Hydrolase Pseudogene 3
  • EC 3.4.17.21 51
  • EC 3.4.-.- 4
  • PSMA-LIKE 3
  • GCPIII 3
  • FOLH1B 5
  • FOLH2 3
  • FOLHP 3
  • GCP3 3
  • PSM 3

External Ids for FOLH1B Gene

Previous HGNC Symbols for FOLH1B Gene

  • FOLH2
  • FOLHP

Previous GeneCards Identifiers for FOLH1B Gene

  • GC11P089034
  • GC11P089392
  • GC11P085629
  • GC11P089371

Summaries for FOLH1B Gene

GeneCards Summary for FOLH1B Gene

FOLH1B (Folate Hydrolase 1B) is a Protein Coding gene. Among its related pathways are One carbon pool by folate and Viral mRNA Translation. Gene Ontology (GO) annotations related to this gene include metallopeptidase activity and dipeptidase activity.

UniProtKB/Swiss-Prot Summary for FOLH1B Gene

  • Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity.
  • Exhibits a dipeptidyl-peptidase IV type activity.

Additional gene information for FOLH1B Gene

No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for FOLH1B Gene

Genomics for FOLH1B Gene

GeneHancer (GH) Regulatory Elements Pubs

Download GeneHancer 2017 data
Promoters and enhancers for FOLH1B Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH11J089634 Enhancer 0.2 dbSUPER 613 -0.1 -90 5.3 FOLH1B TUBAP2 NOX4 RF00004-026
GH11J089606 Enhancer 0.7 Ensembl ENCODE 10.1 -30.2 -30179 4.4 TFE3 GABPA FOXA1 FOXA2 CREB1 GABPB1 JUN LCORL ATF1 ELF3 NOX4 FOLH1B ENSG00000255429 RF00004-026
GH11J089660 Enhancer 0.6 Ensembl dbSUPER 11.2 +22.8 22821 0.4 CTCF SP1 RAD21 HNF4A RXRA FOLH1B lnc-TRIM77-11 TRIM77
GH11J089556 Enhancer 0.7 Ensembl ENCODE 10.1 -80.0 -79975 1.6 FOXA1 RFX1 CTBP1 GATA3 DPF2 JUND PRDM6 SMARCE1 ENSG00000279056 FOLH1B ENSG00000280201 NOX4 ENSG00000255429 TYR
GH11J089616 Enhancer 0.6 Ensembl dbSUPER 9.8 -21.0 -20979 1.2 CTCF RAD21 ESRRA SMC3 ZNF654 FOLH1B RF00004-026 NOX4 ENSG00000255429
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around FOLH1B on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for FOLH1B

Top Transcription factor binding sites by QIAGEN in the FOLH1B gene promoter:
  • AML1a
  • NF-AT
  • NF-AT1
  • NF-AT2
  • NF-AT3
  • NF-AT4
  • POU2F1
  • POU2F1a
  • POU2F2C
  • STAT5A

Genomic Locations for FOLH1B Gene

Genomic Locations for FOLH1B Gene
chr11:89,637,580-89,698,718
(GRCh38/hg38)
Size:
61,139 bases
Orientation:
Plus strand
chr11:89,371,683-89,431,886
(GRCh37/hg19)
Size:
60,204 bases
Orientation:
Plus strand

Genomic View for FOLH1B Gene

Genes around FOLH1B on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FOLH1B Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FOLH1B Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for FOLH1B Gene

Proteins for FOLH1B Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for FOLH1B Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9HBA9-FOH1B_HUMAN
    Recommended name:
    Putative N-acetylated-alpha-linked acidic dipeptidase
    Protein Accession:
    Q9HBA9

    Protein attributes for FOLH1B Gene

    Size:
    442 amino acids
    Molecular mass:
    50045 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    No Data Available

neXtProt entry for FOLH1B Gene

Protein Expression for FOLH1B Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for FOLH1B Gene

Q9HBA9:
  • EPDRYVILGGHRD
  • IEGNYTLRVDCTPL
  • LERAFIDPLGLP
  • SFDSLFSAV
  • PRISKLGSGNDFEVFFQRLGIASGRARYTK

Post-translational modifications for FOLH1B Gene

  • Glycosylation at Asn28, Asn151, Asn168, Asn305, and Asn330
  • Modification sites at PhosphoSitePlus

Other Protein References for FOLH1B Gene

REFSEQ proteins:

Domains & Families for FOLH1B Gene

Gene Families for FOLH1B Gene

IUPHAR :

Protein Domains for FOLH1B Gene

InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for FOLH1B Gene

GenScript: Design optimal peptide antigens:
  • Putative folate hydrolase 1B (FOH1B_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9HBA9

UniProtKB/Swiss-Prot:

FOH1B_HUMAN :
  • Belongs to the peptidase M28 family. M28B subfamily.
Family:
  • Belongs to the peptidase M28 family. M28B subfamily.
genes like me logo Genes that share domains with FOLH1B: view

Function for FOLH1B Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line

Molecular function for FOLH1B Gene

UniProtKB/Swiss-Prot Function:
Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity.
UniProtKB/Swiss-Prot Function:
Exhibits a dipeptidyl-peptidase IV type activity.

Enzyme Numbers (IUBMB) for FOLH1B Gene

Phenotypes From GWAS Catalog for FOLH1B Gene

Gene Ontology (GO) - Molecular Function for FOLH1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004180 carboxypeptidase activity IBA 21873635
GO:0004181 metallocarboxypeptidase activity IDA 17241121
GO:0016805 dipeptidase activity IEA --
GO:0046872 metal ion binding IEA --
genes like me logo Genes that share ontologies with FOLH1B: view
genes like me logo Genes that share phenotypes with FOLH1B: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for FOLH1B

No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for FOLH1B Gene

Localization for FOLH1B Gene

Subcellular locations from UniProtKB/Swiss-Prot for FOLH1B Gene

Cytoplasm.

Gene Ontology (GO) - Cellular Components for FOLH1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005886 plasma membrane IBA, TAS --
GO:0070062 extracellular exosome HDA 23533145
genes like me logo Genes that share ontologies with FOLH1B: view

No data available for Subcellular locations from COMPARTMENTS and Subcellular locations from the Human Protein Atlas (HPA) for FOLH1B Gene

Pathways & Interactions for FOLH1B Gene

genes like me logo Genes that share pathways with FOLH1B: view

Pathways by source for FOLH1B Gene

1 BioSystems pathway for FOLH1B Gene

Interacting Proteins for FOLH1B Gene

Selected Interacting proteins: Q9HBA9-FOH1B_HUMAN for FOLH1B Gene via IID

GPS-Prot Interaction Network for FOLH1B

Gene Ontology (GO) - Biological Process for FOLH1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis IEA --
GO:0008652 cellular amino acid biosynthetic process TAS --
GO:0035609 C-terminal protein deglutamylation IDA 17241121
genes like me logo Genes that share ontologies with FOLH1B: view

No data available for SIGNOR curated interactions for FOLH1B Gene

Drugs & Compounds for FOLH1B Gene

Products:

  1. Drug

(1) Drugs for FOLH1B Gene - From: Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials

(2) Additional Compounds for FOLH1B Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with FOLH1B: view

Transcripts for FOLH1B Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone

mRNA/cDNA for FOLH1B Gene

1 REFSEQ mRNAs :
2 NCBI additional mRNA sequence :
2 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for FOLH1B

Alternative Splicing Database (ASD) splice patterns (SP) for FOLH1B Gene

No ASD Table

Relevant External Links for FOLH1B Gene

GeneLoc Exon Structure for
FOLH1B

Expression for FOLH1B Gene

Products:

  1. Primer
  2. Gene Expression Assay

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for FOLH1B Gene

mRNA expression in normal human tissues for FOLH1B Gene
mRNA expression by GTEx for FOLH1B GenemRNA expression by BioGPS for FOLH1B Gene

mRNA differential expression in normal tissues according to GTEx for FOLH1B Gene

This gene is overexpressed in Liver (x12.4), Brain - Spinal cord (cervical c-1) (x6.8), Kidney - Cortex (x4.8), Prostate (x4.6), and Brain - Substantia nigra (x4.0).

Protein differential expression in normal tissues from HIPED for FOLH1B Gene

This gene is overexpressed in Spinal cord (58.9) and Brain (10.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for FOLH1B Gene



Protein tissue co-expression partners for FOLH1B Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for FOLH1B

SOURCE GeneReport for Unigene cluster for FOLH1B Gene:

Hs.645352

mRNA Expression by UniProt/SwissProt for FOLH1B Gene:

Q9HBA9-FOH1B_HUMAN
Tissue specificity: Kidney and liver. Not expressed in the prostate.
genes like me logo Genes that share expression patterns with FOLH1B: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Evidence on tissue expression from TISSUES and Phenotype-based relationships between genes and organs from Gene ORGANizer for FOLH1B Gene

Orthologs for FOLH1B Gene

Evolution for FOLH1B Gene

ENSEMBL:
Gene Tree for FOLH1B (if available)
TreeFam:
Gene Tree for FOLH1B (if available)

No data available for Orthologs for FOLH1B Gene

Paralogs for FOLH1B Gene

(4) SIMAP similar genes for FOLH1B Gene using alignment to 1 proteins:

  • FOH1B_HUMAN
genes like me logo Genes that share paralogs with FOLH1B: view

No data available for Paralogs for FOLH1B Gene

Variants for FOLH1B Gene

Products:

  1. SNP Genotyping and Copy Number Assay

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for FOLH1B Gene

SNP ID Clinical significance and condition Chr 11 pos Variation AA Info Type
rs10830339 - p.Asn151Lys

Additional dbSNP identifiers (rs#s) for FOLH1B Gene

Structural Variations from Database of Genomic Variants (DGV) for FOLH1B Gene

Variant ID Type Subtype PubMed ID
esv2762931 CNV gain 21179565
esv32702 CNV gain+loss 17666407
esv3579993 CNV gain 25503493
esv3627174 CNV loss 21293372
esv3627175 CNV loss 21293372
esv3627176 CNV gain 21293372
esv3892057 CNV gain 25118596
nsv1043643 CNV gain 25217958
nsv1052092 CNV gain 25217958
nsv468785 CNV gain 19166990
nsv527380 CNV loss 19592680
nsv555770 CNV gain 21841781
nsv975964 CNV duplication 23825009

Additional Variant Information for FOLH1B Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
FOLH1B

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Variation tolerance for FOLH1B Gene

Disorders for FOLH1B Gene

Additional Disease Information for FOLH1B

ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform

No disorders were found for FOLH1B Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for FOLH1B Gene

Publications for FOLH1B Gene

  1. Comparative analysis of prostate-specific membrane antigen (PSMA) versus a prostate-specific membrane antigen-like gene. (PMID: 14716746) O'Keefe DS … Heston WD (The Prostate 2004) 2 3 4 23
  2. Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III. (PMID: 19678840) Hlouchova K … Lubkowski J (The FEBS journal 2009) 3 23
  3. Molecular evolution of the transferrin receptor/glutamate carboxypeptidase II family. (PMID: 17160644) Lambert LA … Mitchell SL (Journal of molecular evolution 2007) 3 23
  4. Biochemical characterization of human glutamate carboxypeptidase III. (PMID: 17241121) Hlouchová K … Konvalinka J (Journal of neurochemistry 2007) 3 23
  5. Mapping, genomic organization and promoter analysis of the human prostate-specific membrane antigen gene. (PMID: 9838072) O'Keefe DS … Heston WD (Biochimica et biophysica acta 1998) 2 3

ExternalLinks

View latest publications for FOLH1B gene in Mastermind

Products for FOLH1B Gene

Sources for FOLH1B Gene