Aliases for FNTB Gene

Aliases for FNTB Gene

  • Farnesyltransferase, CAAX Box, Beta 2 3 5
  • Ras Proteins Prenyltransferase Subunit Beta 3 4
  • Protein Farnesyltransferase Subunit Beta 3 4
  • CAAX Farnesyltransferase Subunit Beta 3 4
  • EC 2.5.1.58 4 51
  • FTase-Beta 3 4
  • FPTB 2 3
  • Epididymis Secretory Sperm Binding Protein 3
  • FNTB 5

External Ids for FNTB Gene

Previous GeneCards Identifiers for FNTB Gene

  • GC14P062781
  • GC14P059247
  • GC14P063443
  • GC14P064523
  • GC14P065381
  • GC14P065454

Summaries for FNTB Gene

CIViC Summary for FNTB Gene

GeneCards Summary for FNTB Gene

FNTB (Farnesyltransferase, CAAX Box, Beta) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and Metabolism of fat-soluble vitamins. Gene Ontology (GO) annotations related to this gene include drug binding and farnesyltranstransferase activity. An important paralog of this gene is CHURC1-FNTB.

UniProtKB/Swiss-Prot Summary for FNTB Gene

  • Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.

Gene Wiki entry for FNTB Gene

Additional gene information for FNTB Gene

No data available for Entrez Gene Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for FNTB Gene

Genomics for FNTB Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for FNTB Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH14J064986 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE CraniofacialAtlas 600.7 +0.4 406 2.2 HNRNPL CREB1 GATAD2A CTCF PRDM10 REST ZNF629 TFE3 SIX5 IKZF1 FNTB HSALNG0101927 LOC107984655 lnc-CHURC1-1 CHURC1 RAB15 SPTB piR-50443-117 CHURC1-FNTB MAX
GH14J064913 Promoter/Enhancer 2 EPDnew Ensembl ENCODE CraniofacialAtlas 600.2 -72.0 -71994 2.6 BRCA1 ARHGAP35 HNRNPL CREB1 GATAD2A TEAD4 ZNF629 RFX1 IKZF1 POLR2A CHURC1 CHURC1-FNTB FNTB ZBTB25 GPX2 ENSG00000214770 SPTB ENSG00000259118 NONHSAG015228.2
GH14J064969 Promoter/Enhancer 1.8 EPDnew Ensembl ENCODE CraniofacialAtlas 600.4 -15.2 -15156 4.1 EZH2 ZNF341 ZFX GATAD2B ZBTB26 PCBP1 CTCF ZNF335 VEZF1 MAZ RAB15 FNTB CHURC1 SPTB lnc-GPX2-2 GPX2 CHURC1-FNTB
GH14J065015 Promoter/Enhancer 0.5 EPDnew Ensembl 600.3 +28.8 28806 1.4 RF00017-1580 FNTB CHURC1-FNTB GPX2 HE856048 MAX
GH14J065042 Promoter/Enhancer 1.4 Ensembl ENCODE dbSUPER 14.8 +57.0 56965 3 LEF1 IKZF1 JUND MTA2 PKNOX1 MTA1 IKZF2 BRD9 DPF2 HDAC1 MN298114-060 MIR4706 FNTB CHURC1-FNTB CHURC1 MAX MN298678-024
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around FNTB on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for FNTB

Top Transcription factor binding sites by QIAGEN in the FNTB gene promoter:
  • Arnt
  • c-Myb
  • C/EBPbeta
  • Egr-1
  • FOXF2
  • Nkx2-2
  • Pax-4a
  • RFX1
  • USF-1
  • USF1

Genomic Locations for FNTB Gene

Genomic Locations for FNTB Gene
chr14:64,986,895-65,062,652
(GRCh38/hg38)
Size:
75,758 bases
Orientation:
Plus strand
chr14:65,381,203-65,529,370
(GRCh37/hg19)
Size:
148,168 bases
Orientation:
Plus strand

Genomic View for FNTB Gene

Genes around FNTB on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FNTB Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FNTB Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for FNTB Gene

Proteins for FNTB Gene

  • Protein details for FNTB Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P49356-FNTB_HUMAN
    Recommended name:
    Protein farnesyltransferase subunit beta
    Protein Accession:
    P49356
    Secondary Accessions:
    • B2RDX6
    • B4E1A0

    Protein attributes for FNTB Gene

    Size:
    437 amino acids
    Molecular mass:
    48774 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Heterodimer of FNTA and FNTB.

    Three dimensional structures from OCA and Proteopedia for FNTB Gene

    Alternative splice isoforms for FNTB Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for FNTB Gene

Selected DME Specific Peptides for FNTB Gene

P49356:
  • RERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRL
  • YHTCYCL
  • NKLVDGCY
  • EAHGGYT
  • CPPSSSP
  • FLQKPVPGFEE
  • WMFHQQALQEYILMCCQCP

Post-translational modifications for FNTB Gene

  • Ubiquitination at Lys63
  • Modification sites at PhosphoSitePlus

Other Protein References for FNTB Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for FNTB Gene

Gene Families for FNTB Gene

Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for FNTB Gene

InterPro:
Blocks:
  • Prenyltransferase/squalene oxidase
ProtoNet:

Suggested Antigen Peptide Sequences for FNTB Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ35979 fis, clone TESTI2013545, highly similar to Protein farnesyltransferase subunit beta (EC 2.5.1.58) (B3KSC2_HUMAN)
  • cDNA FLJ58825, highly similar to Protein farnesyltransferase subunit beta (EC 2.5.1.58) (B4E1A0_HUMAN)
  • Ras proteins prenyltransferase subunit beta (FNTB_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P49356

UniProtKB/Swiss-Prot:

FNTB_HUMAN :
  • Belongs to the protein prenyltransferase subunit beta family.
Family:
  • Belongs to the protein prenyltransferase subunit beta family.
genes like me logo Genes that share domains with FNTB: view

Function for FNTB Gene

Molecular function for FNTB Gene

UniProtKB/Swiss-Prot Function:
Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein]; Xref=Rhea:RHEA:13345, Rhea:RHEA-COMP:10131, Rhea:RHEA-COMP:11535, ChEBI:CHEBI:29950, ChEBI:CHEBI:33019, ChEBI:CHEBI:86019, ChEBI:CHEBI:175763; EC=2.5.1.58; Evidence={ECO:0000269|PubMed:12036349, ECO:0000269|PubMed:12825937, ECO:0000269|PubMed:16893176, ECO:0000269|PubMed:19246009, ECO:0000269|PubMed:8494894};.
GENATLAS Biochemistry:
CAAX farnesyltransferase,beta subunit,promoting the prenylation of Ras,first step of a series of post translational modification of RAS,required for its association with the inner surface of the plasma membrane,also involved in maturation of other proteins including Ras family members,the gamma subunit of G proteins and nuclear lamins

Enzyme Numbers (IUBMB) for FNTB Gene

Phenotypes From GWAS Catalog for FNTB Gene

Gene Ontology (GO) - Molecular Function for FNTB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003824 catalytic activity IEA --
GO:0004659 prenyltransferase activity IEA --
GO:0004660 contributes_to protein farnesyltransferase activity IBA,IDA 19228685
GO:0005515 protein binding IPI 11687658
GO:0008270 zinc ion binding IEA,IDA 16893176
genes like me logo Genes that share ontologies with FNTB: view
genes like me logo Genes that share phenotypes with FNTB: view

Animal Models for FNTB Gene

MGI Knock Outs for FNTB:
  • Fntb Fntb<tm1.1Bbd>
  • Fntb Fntb<tm1b(EUCOMM)Hmgu>
  • Fntb Fntb<tm1.2Mbrg>

Animal Model Products

  • Taconic Biosciences Mouse Models for FNTB

CRISPR Products

miRNA for FNTB Gene

miRTarBase miRNAs that target FNTB

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for FNTB

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for FNTB Gene

Localization for FNTB Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for FNTB gene
Compartment Confidence
cytoskeleton 4
cytosol 4
plasma membrane 1
extracellular 1
mitochondrion 1
nucleus 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for FNTB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005829 cytosol TAS --
GO:0005875 microtubule associated complex IDA 19228685
GO:0005965 protein farnesyltransferase complex IBA,IDA 16893176
genes like me logo Genes that share ontologies with FNTB: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for FNTB Gene

Pathways & Interactions for FNTB Gene

genes like me logo Genes that share pathways with FNTB: view

Pathways by source for FNTB Gene

3 GeneGo (Thomson Reuters) pathways for FNTB Gene
  • G-protein signaling_H-RAS regulation pathway
  • G-protein signaling_K-RAS regulation pathway
  • G-protein signaling_RhoB regulation pathway

SIGNOR curated interactions for FNTB Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for FNTB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0018342 protein prenylation IBA 21873635
GO:0018343 protein farnesylation IBA,IDA 16893176
GO:0022400 regulation of rhodopsin mediated signaling pathway TAS --
genes like me logo Genes that share ontologies with FNTB: view

Drugs & Compounds for FNTB Gene

(18) Drugs for FNTB Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, and HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Carboplatin Approved Pharma Antitumor agent that forms platinum-DNA adducts., Platinum 2588
Paclitaxel Approved, Vet_approved Pharma Tubulin and Bcl2 inhibitor, Taxanes 3701
farnesyl diphosphate Experimental Pharma Antagonist, Agonist, Target 0
(11S)-8-CHLORO-11-[1-(METHYLSULFONYL)PIPERIDIN-4-YL]-6-PIPERAZIN-1-YL-11H-BENZO[5,6]CYCLOHEPTA[1,2-B]PYRIDINE Experimental Pharma Target 0
(20S)-19,20,21,22-TETRAHYDRO-19-OXO-5H-18,20-ETHANO-12,14-ETHENO-6,10-METHENO-18H-BENZ[D]IMIDAZO[4,3-K][1,6,9,12]OXATRIAZA-CYCLOOCTADECOSINE-9-CARBONITRILE Experimental Pharma Target 0

(1) Additional Compounds for FNTB Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • [(ho)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • PYROphosphATE
14000-31-8

(4) ApexBio Compounds for FNTB Gene

Compound Action Cas Number
FTI 277 HCl FTase inhibitor 180977-34-8
LB42708 Selective FTase inhibitor 226929-39-1
Lonafarnib Ftase inhibitor,potent and selective 193275-84-2
Tipifarnib (Zarnestra) Farnesyltransferase inhibitor,potent and specific 192185-72-1
genes like me logo Genes that share compounds with FNTB: view

Drug Products

Transcripts for FNTB Gene

mRNA/cDNA for FNTB Gene

1 REFSEQ mRNAs :
12 NCBI additional mRNA sequence :
8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for FNTB

Alternative Splicing Database (ASD) splice patterns (SP) for FNTB Gene

No ASD Table

Relevant External Links for FNTB Gene

GeneLoc Exon Structure for
FNTB

Expression for FNTB Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for FNTB Gene

mRNA differential expression in normal tissues according to GTEx for FNTB Gene

This gene is overexpressed in Brain - Spinal cord (cervical c-1) (x6.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for FNTB Gene



Protein tissue co-expression partners for FNTB Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for FNTB

SOURCE GeneReport for Unigene cluster for FNTB Gene:

Hs.325531

Evidence on tissue expression from TISSUES for FNTB Gene

  • Kidney(4.2)
  • Eye(4.1)
genes like me logo Genes that share expression patterns with FNTB: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for FNTB Gene

Orthologs for FNTB Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for FNTB Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia FNTB 31
  • 100 (a)
OneToOne
Dog
(Canis familiaris)
Mammalia FNTB 30 31
  • 93.04 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia FNTB 30
  • 92.07 (n)
Mouse
(Mus musculus)
Mammalia Fntb 30 17 31
  • 90.16 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Fntb 30
  • 89.63 (n)
Oppossum
(Monodelphis domestica)
Mammalia -- 31
  • 86 (a)
OneToMany
Platypus
(Ornithorhynchus anatinus)
Mammalia -- 31
  • 69 (a)
OneToMany
Chicken
(Gallus gallus)
Aves -- 31
  • 84 (a)
OneToMany
FNTB 30
  • 76.25 (n)
Lizard
(Anolis carolinensis)
Reptilia -- 31
  • 80 (a)
OneToMany
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia fntb 30
  • 69.58 (n)
Zebrafish
(Danio rerio)
Actinopterygii fntb 30 31
  • 68.92 (n)
OneToMany
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP001729 30
  • 57.33 (n)
Fruit Fly
(Drosophila melanogaster)
Insecta CG17565 30 31 32
  • 57.27 (n)
OneToMany
Worm
(Caenorhabditis elegans)
Secernentea fntb-1 30 31
  • 50.72 (n)
OneToMany
F23B12.6 32
  • 46 (a)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes RAM1 31 33
  • 36 (a)
OneToMany
Thale Cress
(Arabidopsis thaliana)
eudicotyledons ERA1 30
  • 54.25 (n)
Rice
(Oryza sativa)
Liliopsida Os01g0737800 30
  • 56.13 (n)
Os.20991 30
Wheat
(Triticum aestivum)
Liliopsida Ta.7380 30
Corn
(Zea mays)
Liliopsida Zm.14070 30
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 54 (a)
OneToMany
Species where no ortholog for FNTB was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for FNTB Gene

ENSEMBL:
Gene Tree for FNTB (if available)
TreeFam:
Gene Tree for FNTB (if available)
Aminode:
Evolutionary constrained regions (ECRs) for FNTB: view image

Paralogs for FNTB Gene

Paralogs for FNTB Gene

(3) SIMAP similar genes for FNTB Gene using alignment to 3 proteins:

  • FNTB_HUMAN
  • B4DL54_HUMAN
  • B4E1A0_HUMAN
genes like me logo Genes that share paralogs with FNTB: view

Variants for FNTB Gene

Additional dbSNP identifiers (rs#s) for FNTB Gene

Structural Variations from Database of Genomic Variants (DGV) for FNTB Gene

Variant ID Type Subtype PubMed ID
esv2506970 CNV deletion 19546169
esv2665422 CNV deletion 23128226
esv2748779 CNV deletion 23290073
esv2748787 CNV deletion 23290073
esv3551663 CNV deletion 23714750
nsv1070225 CNV deletion 25765185
nsv1108903 CNV deletion 24896259
nsv832816 CNV gain 17160897

Variation tolerance for FNTB Gene

Residual Variation Intolerance Score: 28.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.35; 7.84% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for FNTB Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
FNTB

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for FNTB Gene

Disorders for FNTB Gene

Additional Disease Information for FNTB

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform

No disorders were found for FNTB Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for FNTB Gene

Publications for FNTB Gene

  1. cDNA cloning of the two subunits of human CAAX farnesyltransferase and chromosomal mapping of FNTA and FNTB loci and related sequences. (PMID: 8276393) Andres DA … Francke U (Genomics 1993) 2 3 4
  2. Polymorphisms of the lamina maturation pathway and their association with the metabolic syndrome: the DESIR prospective study. (PMID: 19841875) Fontaine-Bisson B … Morange PE (Journal of molecular medicine (Berlin, Germany) 2010) 3 41
  3. Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium. (PMID: 19862010) Ganesh SK … Lin JP (Nature genetics 2009) 3 41
  4. Conversion of protein farnesyltransferase to a geranylgeranyltransferase. (PMID: 16893176) Terry KL … Beese LS (Biochemistry 2006) 3 4
  5. Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity. (PMID: 15451670) Reid TS … Beese LS (Journal of molecular biology 2004) 3 4

Products for FNTB Gene

Sources for FNTB Gene