This gene encodes the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. The gene product has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic le... See more...

Aliases for FES Gene

Aliases for FES Gene

  • FES Proto-Oncogene, Tyrosine Kinase 2 3 5
  • Feline Sarcoma (Snyder-Theilen) Viral (V-Fes)/Fujinami Avian Sarcoma (PRCII) Viral (V-Fps) Oncogene Homolog 2 3
  • Feline Sarcoma/Fujinami Avian Sarcoma Oncogene Homolog 3 4
  • Oncogene FES, Feline Sarcoma Virus 2 3
  • Tyrosine-Protein Kinase Fes/Fps 3 4
  • Feline Sarcoma Oncogene 2 3
  • Proto-Oncogene C-Fes 3 4
  • Proto-Oncogene C-Fps 3 4
  • EC 2.7.10.2 4 52
  • P93c-Fes 3 4
  • FPS 3 4
  • Proto-Oncogene Tyrosine-Protein Kinase Fes/Fps 3
  • C-Fes/Fps Protein 2
  • EC 2.7.10 52

External Ids for FES Gene

Previous GeneCards Identifiers for FES Gene

  • GC15P087616
  • GC15P084868
  • GC15P089014
  • GC15P089157
  • GC15P089230
  • GC15P091426
  • GC15P067539

Summaries for FES Gene

Entrez Gene Summary for FES Gene

  • This gene encodes the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. The gene product has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis as well as growth factor and cytokine receptor signaling. Alternative splicing results in multiple variants encoding different isoforms.[provided by RefSeq, Jan 2009]

GeneCards Summary for FES Gene

FES (FES Proto-Oncogene, Tyrosine Kinase) is a Protein Coding gene. Diseases associated with FES include Sarcoma and Myeloid Leukemia. Among its related pathways are IL4-mediated signaling events and Development EPO-induced Jak-STAT pathway. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is FER.

UniProtKB/Swiss-Prot Summary for FES Gene

  • Tyrosine-protein kinase that acts downstream of cell surface receptors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, cell attachment and cell spreading. Plays a role in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Acts down-stream of the activated FCER1 receptor and the mast/stem cell growth factor receptor KIT. Plays a role in the regulation of mast cell degranulation. Plays a role in the regulation of cell differentiation and promotes neurite outgrowth in response to NGF signaling. Plays a role in cell scattering and cell migration in response to HGF-induced activation of EZR. Phosphorylates BCR and down-regulates BCR kinase activity. Phosphorylates HCLS1/HS1, PECAM1, STAT3 and TRIM28.

Gene Wiki entry for FES Gene

Additional gene information for FES Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for FES Gene

Genomics for FES Gene

GeneHancer (GH) Regulatory Elements for FES Gene

Promoters and enhancers for FES Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH15J090882 Promoter/Enhancer 1.9 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 525.6 +0.7 723 4.1 ZBTB40 CTCF POLR2G USF1 ZNF10 GABPA REST KLF7 TOE1 MYC FES lnc-HDDC3-3 FURIN lnc-MAN2A2-1
GH15J090867 Promoter/Enhancer 2.6 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 29.5 -12.3 -12334 7 EP300 FOXK2 ZNF217 TCF12 NCOR1 PHF8 JUND FOS ZNF639 ZIC2 FURIN FES ENSG00000259677 UNC45A ENSG00000259314 IQGAP1 NONHSAG017898.2
GH15J090835 Promoter/Enhancer 2.1 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 20.6 -44.4 -44371 6.8 GTF2E2 TEAD4 PHB2 FOS ZIC2 ZBTB10 ZBTB11 AFF1 TARDBP REST FURIN RF00017-1898 FES BLM VPS33B-DT UNC45A MAN2A2 HDDC3 ENSG00000200677 VPS33B
GH15J090862 Enhancer 1.1 FANTOM5 ENCODE dbSUPER 28.7 -20.1 -20107 1.1 ZNF341 FOXA2 OSR2 NR2F2 ZBTB17 FOS CEBPB ZBTB33 NR2C1 JUND lnc-FURIN-3 FES IQGAP1 lnc-FURIN-2
GH15J090928 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE CraniofacialAtlas 12.5 +49.1 49095 8.4 ZBTB40 ZNF217 CTCF SIN3A NRF1 TCF12 POLR2G GTF2E2 PHF8 ZFX UNC45A HDDC3 lnc-PRC1-4 MAN2A2 RCCD1 ENSG00000259314 ENSG00000259212 FES lnc-PRC1-5
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around FES on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for FES

Top Transcription factor binding sites by QIAGEN in the FES gene promoter:
  • AP-1
  • STAT3

Genomic Locations for FES Gene

Genomic Locations for FES Gene
chr15:90,883,695-90,895,776
(GRCh38/hg38)
Size:
12,082 bases
Orientation:
Plus strand
chr15:91,426,925-91,439,006
(GRCh37/hg19)
Size:
12,082 bases
Orientation:
Plus strand

Genomic View for FES Gene

Genes around FES on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FES Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FES Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for FES Gene

Proteins for FES Gene

  • Protein details for FES Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P07332-FES_HUMAN
    Recommended name:
    Tyrosine-protein kinase Fes/Fps
    Protein Accession:
    P07332
    Secondary Accessions:
    • B2R6E6
    • B4DUD0
    • E9PC94
    • E9PC95
    • Q2VXS7
    • Q2VXS8
    • Q2VXT0
    • Q6GTU5

    Protein attributes for FES Gene

    Size:
    822 amino acids
    Molecular mass:
    93497 Da
    Quaternary structure:
    • Homooligomer. Interacts with BCR. Interacts (when activated, via coiled coil domain) with TRIM28. Interacts (via SH2 domain) with phosphorylated EZR, MS4A2/FCER1B and HCLS1/HS1. Interacts with phosphorylated KIT. Interacts with FLT3. Interacts (via F-BAR domain) with soluble tubulin. Interacts (via SH2 domain) with microtubules.
    Miscellaneous:
    • Cellular homolog of retroviral oncogenes. In contrast to the viral oncoproteins, the kinase activity of cellular FSP/FES is tightly regulated, and the kinase is inactive in normal cells in the absence of activating stimuli (PubMed:15485904).

    Three dimensional structures from OCA and Proteopedia for FES Gene

    Alternative splice isoforms for FES Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for FES Gene

Selected DME Specific Peptides for FES Gene

P07332:
  • KAKFLQEA
  • TKKSGVVL
  • RDLAARN
  • NQQTREFVEKG
  • KWTAPEA
  • WYHGAIPR
  • IGRGNFGEVFSGRLRADNT
  • GGDFLTFLR
  • CIHRDLAARNCLV
  • HPNIVRLIGVCTQKQPIYIVMELVQGGDFL
  • LKISDFGMSR
  • RKYQEASKDK
  • KWVLNHED
  • FSLGASPYP
  • QQPLTKKSG
  • LLQDDRHSTSS
  • SQSWAEITSQTE
  • VAVKSCRETLPP
  • YSSESDVWSFGILLWE
  • HAEDLNSGPL
  • RLPCPELCPDAVFRLMEQCWAYEPGQRPSFS
  • EQEREGGRTPTLEILKSH

Post-translational modifications for FES Gene

  • Autophosphorylated on Tyr-713. Phosphorylated by LYN in response to FCER1 activation. Phosphorylated by HCK.
  • Ubiquitination at Lys725
  • Modification sites at PhosphoSitePlus

Domains & Families for FES Gene

Gene Families for FES Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Disease related genes
  • Enzymes
  • Potential drug targets
  • Predicted intracellular proteins

Protein Domains for FES Gene

Suggested Antigen Peptide Sequences for FES Gene

GenScript: Design optimal peptide antigens:
  • Proto-oncogene c-Fps (FES_HUMAN)
  • C-fes/fps protein (Q4JFK7_HUMAN)
  • Fes/fps proto-oncogene (Q4JFK8_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P07332

UniProtKB/Swiss-Prot:

FES_HUMAN :
  • The coiled coil domains are important for regulating the kinase activity. They mediate homooligomerization and probably also interaction with other proteins.
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Fes/fps subfamily.
Domain:
  • The coiled coil domains are important for regulating the kinase activity. They mediate homooligomerization and probably also interaction with other proteins.
  • The N-terminal region including the first coiled coil domain mediates interaction with phosphoinositide-containing membranes.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Fes/fps subfamily.
genes like me logo Genes that share domains with FES: view

Function for FES Gene

Molecular function for FES Gene

UniProtKB/Swiss-Prot Function:
Tyrosine-protein kinase that acts downstream of cell surface receptors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, cell attachment and cell spreading. Plays a role in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Acts down-stream of the activated FCER1 receptor and the mast/stem cell growth factor receptor KIT. Plays a role in the regulation of mast cell degranulation. Plays a role in the regulation of cell differentiation and promotes neurite outgrowth in response to NGF signaling. Plays a role in cell scattering and cell migration in response to HGF-induced activation of EZR. Phosphorylates BCR and down-regulates BCR kinase activity. Phosphorylates HCLS1/HS1, PECAM1, STAT3 and TRIM28.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]; Xref=Rhea:RHEA:10596, Rhea:RHEA-COMP:10136, Rhea:RHEA-COMP:10137, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:46858, ChEBI:CHEBI:82620, ChEBI:CHEBI:456216; EC=2.7.10.2; Evidence={ECO:0000255 PROSITE-ProRule:PRU10028, ECO:0000269 PubMed:11509660, ECO:0000269 PubMed:15485904, ECO:0000269 PubMed:15867340, ECO:0000269 PubMed:18775312, ECO:0000269 PubMed:2656706, ECO:0000269 PubMed:7687763};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Kinase activity is tightly regulated. Activated in response to signaling from a cell surface receptor. Activation probably requires binding of a substrate via the SH2 domain, plus autophosphorylation at Tyr-713. Present in an inactive form in the absence of activating stimuli.
GENATLAS Biochemistry:
feline sarcoma viral (v-fes) oncogene;Fujinami avian sarcoma viral (v-fps) oncogene homolog

Enzyme Numbers (IUBMB) for FES Gene

Phenotypes From GWAS Catalog for FES Gene

Gene Ontology (GO) - Molecular Function for FES Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004713 protein tyrosine kinase activity TAS --
GO:0004715 non-membrane spanning protein tyrosine kinase activity IDA,IBA 15485904
GO:0005102 signaling receptor binding IBA 21873635
GO:0005515 protein binding IPI 18046454
genes like me logo Genes that share ontologies with FES: view
genes like me logo Genes that share phenotypes with FES: view

Animal Models for FES Gene

MGI Knock Outs for FES:
  • Fes Fes<tm2Mcs>
  • Fes Fes<tm1Mcs>
  • Fes Fes<tm2Pag>
  • Fes Fes<tm1b(EUCOMM)Hmgu>

miRNA for FES Gene

miRTarBase miRNAs that target FES

Clone Products

  • Addgene plasmids for FES

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for FES Gene

Localization for FES Gene

Subcellular locations from UniProtKB/Swiss-Prot for FES Gene

Cytoplasm, cytosol. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle. Golgi apparatus. Cell junction, focal adhesion. Note=Distributed throughout the cytosol when the kinase is not activated. Association with microtubules requires activation of the kinase activity. Shuttles between focal adhesions and cell-cell contacts in epithelial cells. Recruited to the lateral cell membrane in polarized epithelial cells by interaction with phosphorylated EZR. Detected at tubular membrane structures in the cytoplasm and at the cell periphery.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for FES gene
Compartment Confidence
plasma membrane 5
cytoskeleton 5
cytosol 5
golgi apparatus 5
nucleus 3
extracellular 1
mitochondrion 1
endoplasmic reticulum 1
endosome 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Nucleoplasm (2)
  • Vesicles (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for FES Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IDA,IEA 11339827
GO:0005794 Golgi apparatus IEA --
GO:0005829 cytosol TAS --
GO:0005856 cytoskeleton IEA --
GO:0005886 plasma membrane IEA --
genes like me logo Genes that share ontologies with FES: view

Pathways & Interactions for FES Gene

genes like me logo Genes that share pathways with FES: view

Pathways by source for FES Gene

3 GeneGo (Thomson Reuters) pathways for FES Gene
  • Development EPO-induced Jak-STAT pathway
  • Immune response IL-4 signaling pathway
  • Neurophysiological process Receptor-mediated axon growth repulsion
3 Qiagen pathways for FES Gene
  • Guidance Cues and Growth Cone Motility
  • IL-4 Pathway
  • Semaphorin Signaling
1 Cell Signaling Technology pathway for FES Gene

SIGNOR curated interactions for FES Gene

Activates:
Inactivates:
Is activated by:

Gene Ontology (GO) - Biological Process for FES Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001578 microtubule bundle formation IEA --
GO:0006468 protein phosphorylation IEA --
GO:0006935 chemotaxis IBA 21873635
GO:0007098 centrosome cycle IEA --
GO:0007155 cell adhesion IBA 21873635
genes like me logo Genes that share ontologies with FES: view

Drugs & Compounds for FES Gene

(18) Drugs for FES Gene - From: DrugBank, ClinicalTrials, ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
fostamatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors 0
Estradiol Approved, Investigational, Vet_approved Pharma Sex hormone 1393
Fulvestrant Approved, Investigational Pharma Antagonist Estrogen receptor antagonist,high affinity, Hormone therapy 277
Polyestradiol phosphate Approved Pharma 1393
Sage Approved Pharma 77

(6) Additional Compounds for FES Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor 58-64-0

(1) ApexBio Compounds for FES Gene

Compound Action Cas Number
Dovitinib (TKI-258, CHIR-258) Multitargeted RTK inhibitor 405169-16-6
genes like me logo Genes that share compounds with FES: view

Drug Products

Transcripts for FES Gene

mRNA/cDNA for FES Gene

4 REFSEQ mRNAs :
13 NCBI additional mRNA sequence :
17 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Clone Products

  • Addgene plasmids for FES

Alternative Splicing Database (ASD) splice patterns (SP) for FES Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b ^ 4a · 4b · 4c ^ 5a · 5b · 5c · 5d ^ 6a · 6b ^ 7a · 7b ^ 8a · 8b · 8c ^ 9a · 9b · 9c ^ 10a · 10b ^
SP1: - - -
SP2:
SP3: - - - - - - -
SP4: - - -
SP5: - - - - - - - - - - - - - - -
SP6:
SP7:
SP8: - - - - - - - - - - - - - - -
SP9: - - - - - - -
SP10: - - - - - - - - -
SP11: - - -
SP12: - -
SP13: -
SP14:
SP15: -
SP16: - -
SP17:

ExUns: 11a · 11b ^ 12a · 12b · 12c · 12d ^ 13a · 13b ^ 14 ^ 15a · 15b ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21a · 21b
SP1: - - -
SP2: - - - -
SP3:
SP4:
SP5: - -
SP6: -
SP7: - - - -
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:

Relevant External Links for FES Gene

GeneLoc Exon Structure for
FES

Expression for FES Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for FES Gene

mRNA differential expression in normal tissues according to GTEx for FES Gene

This gene is overexpressed in Whole Blood (x14.3) and Spleen (x6.8).

Protein differential expression in normal tissues from HIPED for FES Gene

This gene is overexpressed in Spleen (23.7), Peripheral blood mononuclear cells (16.6), Salivary gland (7.2), and Plasma (7.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for FES Gene



Protein tissue co-expression partners for FES Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for FES

SOURCE GeneReport for Unigene cluster for FES Gene:

Hs.7636

mRNA Expression by UniProt/SwissProt for FES Gene:

P07332-FES_HUMAN
Tissue specificity: Widely expressed. Detected in adult colon epithelium (at protein level) (PubMed:16455651, PubMed:19051325). Expressed in melanocytes (at protein level) (PubMed:28463229).

Evidence on tissue expression from TISSUES for FES Gene

  • Nervous system(4.4)
  • Liver(4.3)
  • Bone marrow(2.5)
  • Blood(2.2)
  • Kidney(2.1)
genes like me logo Genes that share expression patterns with FES: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for FES Gene

Orthologs for FES Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for FES Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia FES 31 30
  • 99.47 (n)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia FES 31
  • 93 (a)
OneToOne
dog
(Canis familiaris)
Mammalia FES 31 30
  • 90.61 (n)
OneToOne
cow
(Bos Taurus)
Mammalia FES 31 30
  • 90.23 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Fes 17 31 30
  • 87.1 (n)
rat
(Rattus norvegicus)
Mammalia Fes 30
  • 87.06 (n)
oppossum
(Monodelphis domestica)
Mammalia FES 31
  • 87 (a)
OneToOne
chicken
(Gallus gallus)
Aves FES 31 30
  • 74.11 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia FES 31
  • 56 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia LOC100489191 30
  • 63.98 (n)
zebrafish
(Danio rerio)
Actinopterygii fes 31 30
  • 61.33 (n)
OneToOne
Dr.13023 30
fruit fly
(Drosophila melanogaster)
Insecta Fps85D 31 32
  • 24 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea ZK622.1 32 30
  • 44.63 (n)
T21G5.1 32
  • 38 (a)
W04G5.10 32
  • 37 (a)
frk-1 32
  • 36 (a)
kin-14 32
  • 36 (a)
F26E4.5 32
  • 36 (a)
W02A2.4 32
  • 34 (a)
C25A8.5 32
  • 34 (a)
C35E7.10b 32
  • 34 (a)
C55C3.4 32
  • 34 (a)
ZC581.7 32
  • 34 (a)
F23C8.7 32
  • 34 (a)
spe-8 32
  • 33 (a)
R05H5.4 32
  • 33 (a)
C18H7.4 32
  • 33 (a)
F01D4.3 32
  • 33 (a)
C35E7.10a 32
  • 33 (a)
F57B9.8 32
  • 32 (a)
Y52D5A.2 32
  • 32 (a)
kin-26 32
  • 32 (a)
T25B9.5 32
  • 31 (a)
F46F5.2 32
  • 31 (a)
Y69E1A.3 32
  • 30 (a)
T06C10.3 32
  • 30 (a)
T25B9.4 32
  • 29 (a)
K09B11.5 32
  • 29 (a)
Y116A8C.38 32
  • 28 (a)
Y116A8C.24 32
  • 28 (a)
ZK593.9 32
  • 28 (a)
F59A3.8 32
  • 27 (a)
W03F8.2 32
  • 27 (a)
kin-24 32
  • 27 (a)
R11E3.1 31 32
  • 24 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes CDC15 31
  • 9 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 35 (a)
OneToMany
Species where no ortholog for FES was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for FES Gene

ENSEMBL:
Gene Tree for FES (if available)
TreeFam:
Gene Tree for FES (if available)
Aminode:
Evolutionary constrained regions (ECRs) for FES: view image

Paralogs for FES Gene

genes like me logo Genes that share paralogs with FES: view

Variants for FES Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for FES Gene

SNP ID Clinical significance and condition Chr 15 pos Variation AA Info Type
773300 Benign: not provided 90,889,880(+) A/G MISSENSE_VARIANT
776945 Benign: not provided 90,891,038(+) G/A SYNONYMOUS_VARIANT,INTRON_VARIANT
790155 Benign: not provided 90,892,763(+) G/A SYNONYMOUS_VARIANT
rs34573430 - p.Arg246Gln
rs56041861 - p.Arg85Cys

Additional dbSNP identifiers (rs#s) for FES Gene

Structural Variations from Database of Genomic Variants (DGV) for FES Gene

Variant ID Type Subtype PubMed ID
nsv515661 CNV loss 19592680
nsv833089 CNV loss 17160897
nsv952028 CNV deletion 24416366

Variation tolerance for FES Gene

Residual Variation Intolerance Score: 5.21% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.24; 40.36% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for FES Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
FES

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for FES Gene

Disorders for FES Gene

MalaCards: The human disease database

(7) MalaCards diseases for FES Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
sarcoma
  • connective and soft tissue neoplasm
myeloid leukemia
  • leukemia myelogenous
leukemia
  • leukemias
acute promyelocytic leukemia
  • apl
neurofibrosarcoma
  • neurosarcoma
- elite association - COSMIC cancer census association via MalaCards
Search FES in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

FES_HUMAN
  • Note=Has been shown to act as proto-oncogene in some types of cancer, possibly due to abnormal activation of the kinase. Has been shown to act as tumor suppressor in other types of cancer. Expressed and present as activated kinase in a subset of acute myeloid leukemia patients; promotes survival of leukemia cells (PubMed:20111072). Expression is absent in K562 leukemia cells; ectopic expression of FSP/FES restores myeloid differentiation (PubMed:2656706). May function as tumor suppressor in colorectal cancer; expression is reduced or absent in samples from some colon cancer patients (PubMed:16455651). May function as tumor suppressor in melanoma by preventing melanoma cell proliferation; expression is reduced or absent in samples from some melanoma patients (PubMed:28463229). Ectopic expression of FSP/FES suppresses anchorage-independent growth in colon cancer cell lines (PubMed:16455651). Up-regulated in prostate cancer, and might be a predictor of recurrence after radical surgery (PubMed:16455651). May promote growth of renal carcinoma cells (PubMed:19082481). {ECO:0000269 PubMed:16455651, ECO:0000269 PubMed:19082481, ECO:0000269 PubMed:20111072, ECO:0000269 PubMed:2656706, ECO:0000269 PubMed:28463229}.

Additional Disease Information for FES

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
Tumor Gene Database
(TGDB)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with FES: view

No data available for Genatlas for FES Gene

Publications for FES Gene

  1. Downregulation of the c-Fes protein-tyrosine kinase inhibits the proliferation of human renal carcinoma cells. (PMID: 19082481) Kanda S … Smithgall TE (International journal of oncology 2009) 3 4 23 54
  2. Contributions of F-BAR and SH2 domains of Fes protein tyrosine kinase for coupling to the FcepsilonRI pathway in mast cells. (PMID: 19001085) McPherson VA … Craig AW (Molecular and cellular biology 2009) 3 4 23 54
  3. Structural coupling of SH2-kinase domains links Fes and Abl substrate recognition and kinase activation. (PMID: 18775312) Filippakopoulos P … Knapp S (Cell 2008) 3 4 23 54
  4. The KRAB-associated co-repressor KAP-1 is a coiled-coil binding partner, substrate and activator of the c-Fes protein tyrosine kinase. (PMID: 16792528) Delfino FJ … Smithgall TE (The Biochemical journal 2006) 3 4 23 54
  5. A growth-suppressive function for the c-fes protein-tyrosine kinase in colorectal cancer. (PMID: 16455651) Delfino FJ … Smithgall TE (The Journal of biological chemistry 2006) 3 4 23 54

Products for FES Gene