Free for academic non-profit institutions. Other users need a Commercial license
This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant ... See more...
Aliases for DYRK1A Gene
Aliases for DYRK1A Gene
- Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A 2 3 5
- Dual Specificity Tyrosine-(Y)-Phosphorylation Regulated Kinase 1A 2 3
- Dual Specificity Tyrosine-Phosphorylation-Regulated Kinase 1A 3 4
- Dual Specificity YAK1-Related Kinase 3 4
- Protein Kinase Minibrain Homolog 3 4
- DYRK 3 4
- HP86 3 4
- MNBH 3 4
- MNB 3 4
- Dual-Specificity Tyrosine-(Y)-Phosphorylation Regulated Kinase 1A 2
External Ids for DYRK1A Gene
- HGNC: 3091
- Entrez Gene: 1859
- Ensembl: ENSG00000157540
- OMIM: 600855
- UniProtKB: Q13627
Previous HGNC Symbols for DYRK1A Gene
- DYRK1
- DYRK
- MNBH
Previous GeneCards Identifiers for DYRK1A Gene
- GC21P035317
- GC21P037659
- GC21P037712
- GC21P037660
- GC21P037661
- GC21P038739
- GC21P024215
Summaries for DYRK1A Gene
-
This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms. [provided by RefSeq, Jul 2008]
GeneCards Summary for DYRK1A Gene
DYRK1A (Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A) is a Protein Coding gene. Diseases associated with DYRK1A include Mental Retardation, Autosomal Dominant 7 and Intellectual Disability Syndrome Due To A Dyrk1a Point Mutation. Among its related pathways are Neuroscience and Cell cycle Cell cycle (generic schema). Gene Ontology (GO) annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is DYRK1B.
UniProtKB/Swiss-Prot Summary for DYRK1A Gene
-
Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Modulates alternative splicing by phosphorylating the splice factor SRSF6 (By similarity). Exhibits a substrate preference for proline at position P+1 and arginine at position P-3. Has pro-survival function and negatively regulates the apoptotic process. Promotes cell survival upon genotoxic stress through phosphorylation of SIRT1. This in turn inhibits TP53 activity and apoptosis (By similarity).
-
Dual-specificity tyrosine phosphorylation-regulated kinases (DYRKs) are conserved serine/threonine kinases. DYRKs have been implicated in cell survival, proliferation and differentiation, and in the pathology of Down Syndrome and Alzheimer's disease.
Additional gene information for DYRK1A Gene
- HGNC(3091)
- Entrez Gene(1859)
- Ensembl(ENSG00000157540)
- OMIM(600855)
- UniProtKB(Q13627)
- Open Targets Platform(ENSG00000157540)
- Monarch Initiative
- Search for DYRK1A at DataMed
- Search for DYRK1A at HumanCyc
No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for DYRK1A Gene
Genomics for DYRK1A Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for DYRK1A Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around DYRK1A on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for DYRK1A
- Top Transcription factor binding sites by QIAGEN in the DYRK1A gene promoter:
-
- AP-1
Genomic Locations for DYRK1A Gene
Genomic Locations for DYRK1A Gene
- chr21:37,365,573-37,526,358
- (GRCh38/hg38)
- Size:
- 160,786 bases
- Orientation:
- Plus strand
- chr21:38,738,092-38,889,753
- (GRCh37/hg19)
- Size:
- 151,662 bases
- Orientation:
- Plus strand
Genomic View for DYRK1A Gene
Genes around DYRK1A on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 21q22.13 by HGNC
- 21q22.13 by Entrez Gene
- 21q22.13 by Ensembl
DYRK1A Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for DYRK1A Gene
Proteins for DYRK1A Gene
-
Protein details for DYRK1A Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q13627-DYR1A_HUMAN
- Recommended name:
- Dual specificity tyrosine-phosphorylation-regulated kinase 1A
- Protein Accession:
- Q13627
- O60769
- Q92582
- Q92810
- Q9UNM5
Protein attributes for DYRK1A Gene
- Size:
- 763 amino acids
- Molecular mass:
- 85584 Da
- Quaternary structure:
-
- Interacts RAD54L2/ARIP4 (By similarity). Interacts with CRY2 (By similarity). Interacts with RANBP9 (PubMed:14500717). Interacts with WDR68 (PubMed:14593110). Interacts with SRSF6 (PubMed:22767602). Interacts with SIRT1 (By similarity).
- (Microbial infection) Interacts with human adenovirus 5 E1A protein (PubMed:23864635).
Three dimensional structures from OCA and Proteopedia for DYRK1A Gene
Protein Expression for DYRK1A Gene
Selected DME Specific Peptides for DYRK1A Gene
- Q13627:
-
- QYSDRRQ
- SHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTL
- HDTEMKYYIVHLK
- AMDCETHSPQVRQQFP
- YDLAIDMWSLGCILVEMHTGEPLFSG
- ALQHSFF
- WMDRYEIDSLIGK
- PYYALQH
- DQIQQPL
- SNPRQETGI
- FRGVSLNLTRK
- IVEVLGIPPA
- EYKPPGTRKLHN
- LSYNLYDLLRNT
- EAPTQVT
- NEVDQMNKIVEVLG
- DLIKTYKHIN
- IGKGSFGQV
- NPKRSAIKI
- QAPKARK
- ETHPVQETTFHV
Post-translational modifications for DYRK1A Gene
- Autophosphorylated on numerous tyrosine residues. Can also autophosphorylate on serine and threonine residues (in vitro).
- Modification sites at PhosphoSitePlus
- Modification sites at neXtProt
Other Protein References for DYRK1A Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- LifeSpan BioSciences DYRK / DYRK1A Antibody
- G Biosciences Immunotag™ DYR1A Antibody
- NSJ Bioreagents DYRK1A Antibody
- Creative Diagnostics Anti-DYRK1A monoclonal antibody, clone 8E20
-
Custom Antibody ServicesOriGene Antibodies for DYRK1A
- Novus Biologicals Antibodies for DYRK1A
-
Abcam antibodies for DYRK1A
- Invitrogen Antibodies for DYRK1A (AFLGC-DYRK1A)
-
Custom Antibody ServicesProSci Antibodies for DYRK1A
-
Santa Cruz Biotechnology (SCBT) Antibodies for DYRK1A
Protein Products
- Creative Biomart Recombinant Human DYRK1A
- Search Origene for MassSpec and Protein Over-expression Lysates for DYRK1A
- Origene Custom Protein Services for DYRK1A
- ProSpec Recombinant Proteins for DYRK1A
-
Abcam proteins for DYRK1A
Assay Products
-
Boster Bio ELISA Kits for DYRK1A
Domains & Families for DYRK1A Gene
Gene Families for DYRK1A Gene
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Disease related genes
- Enzymes
- Potential drug targets
- Predicted intracellular proteins
Protein Domains for DYRK1A Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for DYRK1A Gene
- GenScript: Design optimal peptide antigens:
-
- Protein kinase minibrain homolog (DYR1A_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q13627UniProtKB/Swiss-Prot:
DYR1A_HUMAN :- The polyhistidine repeats act as targeting signals to nuclear speckles.
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
- Domain:
-
- The polyhistidine repeats act as targeting signals to nuclear speckles.
- Family:
-
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
Function for DYRK1A Gene
Molecular function for DYRK1A Gene
- UniProtKB/Swiss-Prot Function:
- Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Modulates alternative splicing by phosphorylating the splice factor SRSF6 (By similarity). Exhibits a substrate preference for proline at position P+1 and arginine at position P-3. Has pro-survival function and negatively regulates the apoptotic process. Promotes cell survival upon genotoxic stress through phosphorylation of SIRT1. This in turn inhibits TP53 activity and apoptosis (By similarity).
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.12.1; Evidence={ECO:0000269|PubMed:20981014, ECO:0000269|PubMed:22998443, ECO:0000269|PubMed:23665168, ECO:0000269|PubMed:24239188};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.12.1; Evidence={ECO:0000269|PubMed:20981014, ECO:0000269|PubMed:22998443, ECO:0000269|PubMed:23665168, ECO:0000269|PubMed:24239188};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]; Xref=Rhea:RHEA:10596, Rhea:RHEA-COMP:10136, Rhea:RHEA-COMP:10137, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:46858, ChEBI:CHEBI:82620, ChEBI:CHEBI:456216; EC=2.7.12.1; Evidence={ECO:0000269|PubMed:20981014, ECO:0000269|PubMed:22998443, ECO:0000269|PubMed:23665168, ECO:0000269|PubMed:24239188};.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Inhibited by RANBP9 (PubMed:14500717). Inhibited by harmine, leucettamine B and leucettine L41 (PubMed:22998443).
- GENATLAS Biochemistry:
- dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1,Drosophila minibrain homolog Dres27,mouse homolog ubiquitously expressed at low levels in embryo,expressed in adult central nervous system -cortex,hippocampus,striatum and spinal cord) located in the Down syndrome critical region (DCR),involved in post-embryonic neurogenesis,putatively overexpressed in Down syndrome and involved in the learning defect and in hypotonia
Enzyme Numbers (IUBMB) for DYRK1A Gene
Phenotypes From GWAS Catalog for DYRK1A Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0003713 | transcription coactivator activity | IBA | 21873635 |
| GO:0004672 | protein kinase activity | TAS | -- |
| GO:0004674 | protein serine/threonine kinase activity | NAS | 28386764 |
| GO:0004712 | protein serine/threonine/tyrosine kinase activity | IEA | -- |
Phenotypes for DYRK1A Gene
- MGI mutant phenotypes for DYRK1A:
-
inferred from 3 alleles
- nervous system phenotype
- immune system phenotype
- cardiovascular system phenotype
- cellular phenotype
- behavior/neurological phenotype
- mortality/aging
- growth/size/body region phenotype
- liver/biliary system phenotype
- endocrine/exocrine gland phenotype
- reproductive system phenotype
- hematopoietic system phenotype
- embryo phenotype
- GenomeRNAi human phenotypes for DYRK1A:
-
- Increased vaccinia virus (VACV) infection
- no effect
- Decreased viability
- Increased cell death HMECs cells
- shRNA abundance <= 50%
- shRNA abundance <= 25%
- Decreased viability after Maraba virus infection
- Negative genetic interaction between MUS81-/- and MUS81+/+
- Decreased substrate adherent cell growth
- No cells
- Increased epidermal growth factor (EGF) endocytosis, decreased endosome-nucleus distance (endosomes clustered in the perinuclear region)
- Decreased mitotic index
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Increased colony dispersion (increased number of colonies and decreased number of cells per colony)
- Increased mitotic index
- Increased viability
- Decreased 12E8 tau but not total tau protein expression and decreased ratio of 12E8/total tau protein expression
Animal Models for DYRK1A Gene
- MGI Knock Outs for DYRK1A:
-
- Dyrk1a Dyrk1a<tm1Mla>
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for DYRK1A - Select products 50% OFF >
- * DYRK1A CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for DYRK1A
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for DYRK1A
-
Santa Cruz Biotechnology (SCBT) CRISPR for DYRK1A
miRNA for DYRK1A Gene
- miRTarBase miRNAs that target DYRK1A
-
- mmu-miR-199b-3p (MIRT005944)
- mmu-miR-15a-5p (MIRT011862)
- hsa-miR-335-5p (MIRT017031)
- hsa-miR-215-5p (MIRT024657)
- hsa-miR-148a-3p (MIRT026006)
- hsa-miR-192-5p (MIRT026227)
- hsa-miR-324-5p (MIRT043199)
- hsa-miR-99b-5p (MIRT044178)
- hsa-miR-92a-3p (MIRT049774)
- hsa-miR-1246 (MIRT053774)
- hsa-miR-224-3p (MIRT085345)
- hsa-miR-522-3p (MIRT085346)
- hsa-miR-620 (MIRT085347)
- hsa-miR-2113 (MIRT085348)
- hsa-miR-298 (MIRT085349)
- hsa-miR-1270 (MIRT085350)
- hsa-miR-5680 (MIRT085353)
- hsa-miR-6880-5p (MIRT085355)
- hsa-miR-26a-5p (MIRT203408)
- hsa-miR-26b-5p (MIRT203409)
- hsa-miR-455-5p (MIRT203435)
- hsa-miR-2682-3p (MIRT351232)
- hsa-miR-6781-3p (MIRT351238)
- hsa-miR-6844 (MIRT507502)
- hsa-miR-3944-5p (MIRT507503)
- hsa-miR-143-5p (MIRT507504)
- hsa-miR-3165 (MIRT507505)
- hsa-miR-8071 (MIRT507506)
- hsa-miR-4683 (MIRT507507)
- hsa-miR-3152-5p (MIRT642124)
- hsa-miR-6836-3p (MIRT642125)
- hsa-miR-5692a (MIRT642126)
- hsa-miR-335-3p (MIRT668625)
- hsa-miR-30e-3p (MIRT668626)
- hsa-miR-30d-3p (MIRT668627)
- hsa-miR-30a-3p (MIRT668628)
- hsa-miR-550b-2-5p (MIRT668629)
- hsa-miR-3157-5p (MIRT668630)
- hsa-miR-550a-5p (MIRT668631)
- hsa-miR-550a-3-5p (MIRT668632)
- hsa-miR-1271-3p (MIRT668633)
- hsa-miR-3135a (MIRT668634)
- hsa-miR-4716-5p (MIRT668635)
- hsa-miR-5685 (MIRT668636)
- hsa-miR-4690-3p (MIRT668637)
- hsa-miR-7151-5p (MIRT668638)
- rno-miR-187-3p (MIRT732357)
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DYRK1A
- Browse OriGene Inhibitory RNA Products For DYRK1A
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DYRK1A
Clone Products
- Applied Biological Materials (abm): Clones for DYRK1A - Select products 50% OFF >
- * DYRK1A as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
- MG221655
- MG222954
- MR221655
- MR221655L3
- MR221655L4
- MR222954
- MR222954L3
- MR222954L4
- RC212584
- RC212584L1
- RC212584L2
- RC212584L3
- RC212584L4
- RC213183
- RC213183L3
- RC213183L4
- RC213280
- RC213280L1
- RC213280L2
- RC213280L3
- RC213280L4
- RC215138
- RC215138L3
- RC215138L4
- RG212584
- RG213183
- RG213280
- RG215138
- RR214059
- RR214059L3
- RR214059L4
- MR221655L3V
- MR221655L4V
- MR222954L3V
- MR222954L4V
- RC212584L1V
- RC212584L2V
- RC212584L3V
- RC212584L4V
- RC213183L3V
- RC213183L4V
- RC213280L1V
- RC213280L2V
- RC213280L3V
- RC213280L4V
- RC215138L3V
- RC215138L4V
- RR214059L3V
- RR214059L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for DYRK1A
- Addgene plasmids for DYRK1A
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for DYRK1A
No data available for Transcription Factor Targets and HOMER Transcription for DYRK1A Gene
Localization for DYRK1A Gene
Subcellular locations from UniProtKB/Swiss-Prot for DYRK1A Gene
- Nucleus. Nucleus speckle.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 4 |
| cytoskeleton | 3 |
| plasma membrane | 2 |
| extracellular | 2 |
| mitochondrion | 2 |
| endoplasmic reticulum | 2 |
| peroxisome | 1 |
| endosome | 1 |
| lysosome | 1 |
| golgi apparatus | 1 |
- Cytosol (2)
- Nucleoli fibrillar center (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | TAS,ISS | -- |
| GO:0005654 | nucleoplasm | TAS | -- |
| GO:0005737 | cytoplasm | IEA,TAS | 24327345 |
| GO:0005856 | colocalizes_with cytoskeleton | IEA,IDA | 24327345 |
| GO:0016607 | nuclear speck | TAS | 28377597 |
Pathways & Interactions for DYRK1A Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Cell Cycle, Mitotic |
.83
|
|
| 2 | Neuroscience | ||
| 3 | Notch Signaling Pathway (WikiPathways) | ||
| 4 | Cell cycle Cell cycle (generic schema) |
.31
|
|
| 5 | Mitotic G1-G1/S phases | ||
Pathways by source for DYRK1A Gene
2 BioSystems pathways for DYRK1A Gene
4 Reactome pathways for DYRK1A Gene
1 GeneGo (Thomson Reuters) pathway for DYRK1A Gene
- Translation Regulation of EIF2 activity
1 R&D Systems pathway for DYRK1A Gene
1 Cell Signaling Technology pathway for DYRK1A Gene
Interacting Proteins for DYRK1A Gene
Selected Interacting proteins:
Q13627-DYR1A_HUMAN
ENSP00000381932
for DYRK1A Gene via
UniProtKB
MINT
STRING
IID
GPS-Prot Interaction Network for DYRK1A
SIGNOR curated interactions for DYRK1A Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000381 | regulation of alternative mRNA splicing, via spliceosome | IEA | -- |
| GO:0006468 | protein phosphorylation | TAS | 24327345 |
| GO:0007399 | nervous system development | TAS | 8769099 |
| GO:0007623 | circadian rhythm | IEA,ISS | -- |
| GO:0016032 | viral process | IEA | -- |
Drugs & Compounds for DYRK1A Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| fostamatinib | Approved, Investigational | Pharma | Target, inhibitor | Kinase Inhibitors | 0 | |
| N-(5-{[(2S)-4-amino-2-(3-chlorophenyl)butanoyl]amino}-1H-indazol-3-yl)benzamide | Experimental | Pharma | Target | 0 | ||
| Harmine | Experimental | Pharma | Potent and selective DYRK1A inhibitor | 1 | ||
| ATP | Investigational | Nutra | Agonist, Activator, Partial agonist, Antagonist, Full agonist, Gating inhibitor, Pore Blocker, Potentiation | 0 | ||
| ID-8 | Pharma | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Agonist, Full agonist, Partial agonist, Gating inhibitor, Antagonist | 58-64-0 |
|
(3) Tocris Compounds for DYRK1A Gene
(1) ApexBio Compounds for DYRK1A Gene
| Compound | Action | Cas Number |
|---|---|---|
| ID-8 | 147591-46-6 |
Transcripts for DYRK1A Gene
mRNA/cDNA for DYRK1A Gene
- 8 REFSEQ mRNAs :
- 17 NCBI additional mRNA sequence :
- 24 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000646523 2153 nts (view in UCSC)
- ENST00000647425 2737 nts (view in UCSC)
- ENST00000647504 5591 nts (view in UCSC)
- ENST00000644942 3137 nts (view in UCSC)
- ENST00000647188 17024 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for DYRK1A - Select products 50% OFF >
- * DYRK1A CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for DYRK1A
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for DYRK1A
-
Santa Cruz Biotechnology (SCBT) CRISPR for DYRK1A
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DYRK1A
- Browse OriGene Inhibitory RNA Products For DYRK1A
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DYRK1A
Clone Products
- Applied Biological Materials (abm): Clones for DYRK1A - Select products 50% OFF >
- * DYRK1A as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
- MG221655
- MG222954
- MR221655
- MR221655L3
- MR221655L4
- MR222954
- MR222954L3
- MR222954L4
- RC212584
- RC212584L1
- RC212584L2
- RC212584L3
- RC212584L4
- RC213183
- RC213183L3
- RC213183L4
- RC213280
- RC213280L1
- RC213280L2
- RC213280L3
- RC213280L4
- RC215138
- RC215138L3
- RC215138L4
- RG212584
- RG213183
- RG213280
- RG215138
- RR214059
- RR214059L3
- RR214059L4
- MR221655L3V
- MR221655L4V
- MR222954L3V
- MR222954L4V
- RC212584L1V
- RC212584L2V
- RC212584L3V
- RC212584L4V
- RC213183L3V
- RC213183L4V
- RC213280L1V
- RC213280L2V
- RC213280L3V
- RC213280L4V
- RC215138L3V
- RC215138L4V
- RR214059L3V
- RR214059L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for DYRK1A
- Addgene plasmids for DYRK1A
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for DYRK1A
| ExUns: | 1 | ^ | 2a | · | 2b | · | 2c | ^ | 3 | ^ | 4a | · | 4b | ^ | 5a | · | 5b | ^ | 6a | · | 6b | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | ^ | 14 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | |||||||||||||||||||||||||||||||||||||
| SP3: | - | ||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | ||||||||||||||||||||||||||||||||||||
| SP5: | - | - | - | - | |||||||||||||||||||||||||||||||||||
| SP6: | - | - | - | - | - |
Relevant External Links for DYRK1A Gene
- GeneLoc Exon Structure for
- DYRK1A
Expression for DYRK1A Gene
This gene is overexpressed in Fetal Brain (10.8), Heart (10.1), Peripheral blood mononuclear cells (8.8), Placenta (8.0), and Fetal ovary (7.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for DYRK1A Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for DYRK1A
SOURCE GeneReport for Unigene cluster for DYRK1A Gene:
Hs.368240mRNA Expression by UniProt/SwissProt for DYRK1A Gene:
Q13627-DYR1A_HUMAN
Tissue specificity:
Ubiquitous. Highest levels in skeletal muscle, testis, fetal lung and fetal kidney.
Evidence on tissue expression from TISSUES for DYRK1A Gene
- Nervous system(4.9)
- Liver(4.5)
- Muscle(2.9)
- Skin(2.8)
- Kidney(2.7)
- Heart(2.7)
- Blood(2.7)
- Intestine(2.7)
- Bone marrow(2.5)
- Pancreas(2.4)
- Thyroid gland(2.3)
- Adrenal gland(2.2)
- Spleen(2.2)
- Lung(2.2)
- Lymph node(2.1)
Phenotype-based relationships between genes and organs from Gene ORGANizer for DYRK1A Gene
Germ Layers:
- ectoderm
- endoderm
- mesoderm
Systems:
- cardiovascular
- digestive
- immune
- integumentary
- nervous
- respiratory
- skeletal muscle
- skeleton
Regions:
Head and neck:
- brain
- cerebellum
- chin
- cranial nerve
- ear
- eye
- eyelid
- face
- forehead
- head
- jaw
- lip
- mandible
- maxilla
- mouth
- nose
- outer ear
- pharynx
- skull
- tooth
Thorax:
- chest wall
- heart
Abdomen:
- abdominal wall
- intestine
- large intestine
Pelvis:
- rectum
Limb:
- digit
- finger
- foot
- hand
- lower limb
- toe
- upper limb
General:
- blood
- blood vessel
- hair
- peripheral nerve
- peripheral nervous system
- skin
- spinal cord
- white blood cell
Primer Products
-
OriGene qPCR primer pairs for DYRK1A
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for DYRK1A Gene
Orthologs for DYRK1A Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | DYRK1A 30 31 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | DYRK1A 31 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | DYRK1A 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | DYRK1A 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | DYRK1A 30 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Dyrk1a 30 |
|
||
| Mouse (Mus musculus) |
Mammalia | Dyrk1a 30 17 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | DYRK1A 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | DYRK1A 31 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | dyrk1a 30 |
|
||
| Str.507 30 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | dyrk1a-prov 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | dyrk1ab 31 |
|
OneToMany | |
| dyrk1aa 30 31 |
|
OneToMany | |||
| Fruit Fly (Drosophila melanogaster) |
Insecta | mnb 31 32 |
|
OneToMany | |
| Worm (Caenorhabditis elegans) |
Secernentea | mbk-1 31 32 |
|
OneToMany | |
| Baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | YAK1 31 |
|
OneToMany | |
| Rice (Oryza sativa) |
Liliopsida | Os.14313 30 |
|
||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | CSA.1202 31 |
|
OneToMany | |
| Sea Vase (Ciona intestinalis) |
Ascidiacea | Cin.4844 30 |
|
- Species where no ortholog for DYRK1A was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for DYRK1A Gene
- ENSEMBL:
- Gene Tree for DYRK1A (if available)
- TreeFam:
- Gene Tree for DYRK1A (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for DYRK1A: view image
Paralogs for DYRK1A Gene
Paralogs for DYRK1A Gene
(14) SIMAP similar genes for DYRK1A Gene using alignment to 4 proteins:
- DYR1A_HUMAN
- E7EMI5_HUMAN
- F8W9I9_HUMAN
- F8WAP0_HUMAN
Variants for DYRK1A Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for DYRK1A Gene
| SNP ID | Clinical significance and condition | Chr 21 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| 641739 | Uncertain Significance: Mental retardation, autosomal dominant 7 | 37,512,364(+) | C/T | MISSENSE_VARIANT,THREE_PRIME_UTR_VARIANT | |
| 641967 | Uncertain Significance: Mental retardation, autosomal dominant 7 | 37,506,161(+) | CA/C | FRAMESHIFT_VARIANT,INTRON_VARIANT | |
| 651500 | Uncertain Significance: Mental retardation, autosomal dominant 7 | 37,472,842(+) | T/C | MISSENSE_VARIANT | |
| 655610 | Likely Pathogenic: Mental retardation, autosomal dominant 7 | 37,480,821(+) | G/A | MISSENSE_VARIANT | |
| 656015 | Uncertain Significance: Mental retardation, autosomal dominant 7 | 37,478,227(+) | T/G | MISSENSE_VARIANT |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv1270e212 | CNV | loss | 25503493 |
| dgv1271e212 | CNV | loss | 25503493 |
| esv1001034 | CNV | deletion | 20482838 |
| esv3377435 | CNV | insertion | 20981092 |
| esv3646991 | CNV | loss | 21293372 |
| nsv1059823 | CNV | gain | 25217958 |
| nsv1136635 | CNV | deletion | 24896259 |
| nsv834096 | CNV | loss | 17160897 |
| nsv953362 | CNV | duplication | 24416366 |
Residual Variation Intolerance Score:
11.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.30;
25.88% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for DYRK1A Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DYRK1A Gene
Disorders for DYRK1A Gene
(23) MalaCards diseases for DYRK1A Gene - From: OMIM, ClinVar, GTR, Orphanet, DISEASES, Novoseek, and GeneCards
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| mental retardation, autosomal dominant 7 |
|
|
| intellectual disability syndrome due to a dyrk1a point mutation |
|
|
| microphthalmia |
|
|
| microcephaly |
|
|
| alacrima, achalasia, and mental retardation syndrome |
|
Search DYRK1A in MalaCards
View complete list of genes associated with diseases
UniProtKB/Swiss-Prot
DYR1A_HUMAN- Mental retardation, autosomal dominant 7 (MRD7) [MIM:614104]: A disease characterized by primary microcephaly, severe mental retardation without speech, anxious autistic behavior, and dysmorphic features, including bitemporal narrowing, deep-set eyes, large simple ears, and a pointed nasal tip. Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. {ECO:0000269 PubMed:21294719, ECO:0000269 PubMed:23160955}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Additional Disease Information for DYRK1A
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
No data available for Genatlas for DYRK1A Gene
Publications for DYRK1A Gene
- DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1. (PMID: 20167603) Guo X … Li X (The Journal of biological chemistry 2010) 3 4 23
- DYRK1A genetic variants are not linked to Alzheimer's disease in a Spanish case-control cohort. (PMID: 19995442) Vázquez-Higuera JL … Combarros O (BMC medical genetics 2009) 3 23 41
- Human minibrain homologue (MNBH/DYRK1): characterization, alternative splicing, differential tissue expression, and overexpression in Down syndrome. (PMID: 10329007) Guimera J … Pritchard M (Genomics 1999) 3 4 23
- Gene identification in 1.6-Mb region of the Down syndrome region on chromosome 21. (PMID: 9037601) Ohira M … Ohki M (Genome research 1997) 3 4 23
- Minibrain (MNBH) is a single copy gene mapping to human chromosome 21q22.2. (PMID: 9284911) Guimera J … Estivill X (Cytogenetics and cell genetics 1997) 2 3 23
ExternalLinks
Products for DYRK1A Gene
- Custom Antibody ServicesOriGene Antibodies for DYRK1A
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for DYRK1A
- Origene Custom Protein Services for DYRK1A
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DYRK1A
- Browse OriGene Inhibitory RNA Products For DYRK1A
- OriGene qPCR primer pairs for DYRK1A
- OriGene CRISPR knockouts for DYRK1A
- MG221655
- MG222954
- MR221655
- MR221655L3
- MR221655L4
- MR222954
- MR222954L3
- MR222954L4
- RC212584
- RC212584L1
- RC212584L2
- RC212584L3
- RC212584L4
- RC213183
- RC213183L3
- RC213183L4
- RC213280
- RC213280L1
- RC213280L2
- RC213280L3
- RC213280L4
- RC215138
- RC215138L3
- RC215138L4
- RG212584
- RG213183
- RG213280
- RG215138
- RR214059
- RR214059L3
- RR214059L4
- MR221655L3V
- MR221655L4V
- MR222954L3V
- MR222954L4V
- RC212584L1V
- RC212584L2V
- RC212584L3V
- RC212584L4V
- RC213183L3V
- RC213183L4V
- RC213280L1V
- RC213280L2V
- RC213280L3V
- RC213280L4V
- RC215138L3V
- RC215138L4V
- RR214059L3V
- RR214059L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For DYRK1A
- Sino Biological Human cDNA Clone for DYRK1A
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for DYRK1A
- Novus Biologicals proteins and lysates for DYRK1A
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for DYRK1A
- Abcam proteins for DYRK1A
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ApexBio compounds for DYRK1A
- VectorBuilder Custom and pre-made DNA vectors for DYRK1A (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for DYRK1A (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for DYRK1A (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for DYRK1A CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for DYRK1A
- Addgene plasmids for DYRK1A
- antibodies-online: Show 86 available DYRK1A Antibodies ranked by validation data
- Compare Top DYRK1A Antibodies
- antibodies-online: Show 10 available DYRK1A Elisa Kits ranked by validation data
- Compare Top DYRK1A Elisa Kits
- antibodies-online: Show 11 available DYRK1A Proteins ranked by validation data
- Compare Top DYRK1A Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for DYRK1A
- Search Santa Cruz Biotechnology (SCBT) for DYRK1A siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for DYRK1A
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for DYRK1A
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for DYRK1A
- Search GeneCopoeia for miRNA 3'UTR Target clone products for DYRK1A
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DYRK1A
Sources for DYRK1A Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177) snoDB
- (178) MirGeneDB