This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found i... See more...

Aliases for DNMT1 Gene

Aliases for DNMT1 Gene

  • DNA Methyltransferase 1 2 3 5
  • CXXC9 2 3 4
  • MCMT 2 3 4
  • DNA (Cytosine-5-)-Methyltransferase 1 2 3
  • DNA (Cytosine-5)-Methyltransferase 1 3 4
  • CXXC-Type Zinc Finger Protein 9 3 4
  • DNA Methyltransferase HsaI 3 4
  • DNA MTase HsaI 3 4
  • EC 2.1.1.37 4 50
  • M.HsaI 3 4
  • DNMT 3 4
  • AIM 3 4
  • ADCADN 3
  • HSN1E 3
  • DNMT1 5
  • Dnmt1 4

External Ids for DNMT1 Gene

Previous HGNC Symbols for DNMT1 Gene

  • DNMT

Previous GeneCards Identifiers for DNMT1 Gene

  • GC19M010365
  • GC19M010466
  • GC19M010089
  • GC19M010105
  • GC19M010244
  • GC19M009824

Summaries for DNMT1 Gene

Entrez Gene Summary for DNMT1 Gene

  • This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

CIViC Summary for DNMT1 Gene

GeneCards Summary for DNMT1 Gene

DNMT1 (DNA Methyltransferase 1) is a Protein Coding gene. Diseases associated with DNMT1 include Cerebellar Ataxia, Deafness, And Narcolepsy, Autosomal Dominant and Neuropathy, Hereditary Sensory, Type Ie. Among its related pathways are One carbon pool by folate and Macrophage Differentiation and Growth Inhibition by METS. Gene Ontology (GO) annotations related to this gene include RNA binding and transcription factor binding. An important paralog of this gene is TRDMT1.

UniProtKB/Swiss-Prot Summary for DNMT1 Gene

  • Methylates CpG residues. Preferentially methylates hemimethylated DNA. Associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance. Associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones. Mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. Probably forms a corepressor complex required for activated KRAS-mediated promoter hypermethylation and transcriptional silencing of tumor suppressor genes (TSGs) or other tumor-related genes in colorectal cancer (CRC) cells (PubMed:24623306). Also required to maintain a transcriptionally repressive state of genes in undifferentiated embryonic stem cells (ESCs) (PubMed:24623306). Associates at promoter regions of tumor suppressor genes (TSGs) leading to their gene silencing (PubMed:24623306). Promotes tumor growth (PubMed:24623306).

Tocris Summary for DNMT1 Gene

  • Protein arginine methyltransferases are enyzmes that catalyze the transfer of methyl groups from S-adenosylmethionine (SAM) to the arginine residues on histones and other proteins. The dysregulation of this methylation is critical in the development of certain cancers.

Gene Wiki entry for DNMT1 Gene

No data available for PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for DNMT1 Gene

Genomics for DNMT1 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for DNMT1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around DNMT1 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for DNMT1

Top Transcription factor binding sites by QIAGEN in the DNMT1 gene promoter:
  • AML1a

Genomic Locations for DNMT1 Gene

Latest Assembly
chr19:10,133,342-10,231,286
(GRCh38/hg38)
Size:
97,945 bases
Orientation:
Minus strand

Previous Assembly
chr19:10,244,022-10,305,629
(GRCh37/hg19 by Entrez Gene)
Size:
61,608 bases
Orientation:
Minus strand

chr19:10,244,021-10,341,962
(GRCh37/hg19 by Ensembl)
Size:
97,942 bases
Orientation:
Minus strand

Genomic View for DNMT1 Gene

Genes around DNMT1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DNMT1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DNMT1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DNMT1 Gene

Proteins for DNMT1 Gene

  • Protein details for DNMT1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P26358-DNMT1_HUMAN
    Recommended name:
    DNA (cytosine-5)-methyltransferase 1
    Protein Accession:
    P26358
    Secondary Accessions:
    • A0AV63
    • B7ZLW6
    • Q9UHG5
    • Q9ULA2
    • Q9UMZ6

    Protein attributes for DNMT1 Gene

    Size:
    1616 amino acids
    Molecular mass:
    183165 Da
    Quaternary structure:
    • Homodimer (PubMed:19173286). Forms a stable complex with E2F1, BB1 and HDAC1 (PubMed:10888886). Forms a complex with DMAP1 and HDAC2, with direct interaction (PubMed:10888872). Interacts with the PRC2/EED-EZH2 complex (PubMed:16357870). Probably part of a corepressor complex containing ZNF304, TRIM28, SETDB1 and DNMT1 (PubMed:24623306). Interacts with UHRF1; promoting its recruitment to hemimethylated DNA (PubMed:21745816). Interacts with USP7, promoting its deubiquitination (PubMed:21745816). Interacts with PCNA (PubMed:9302295). Interacts with MBD2 and MBD3 (PubMed:10947852). Interacts with DNMT3A and DNMT3B (PubMed:12145218). Interacts with UBC9 (PubMed:19450230). Interacts with CSNK1D (By similarity). Interacts with HDAC1 (By similarity). Interacts with BAZ2A/TIP5 (By similarity). Interacts with SIRT7 (By similarity).
    SequenceCaution:
    • Sequence=AAD54507.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for DNMT1 Gene

    Alternative splice isoforms for DNMT1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DNMT1 Gene

Selected DME Specific Peptides for DNMT1 Gene

P26358:
  • NRFTEDSLLRHAQFVV
  • TVFTEDCN
  • EMPSPKK
  • TLIPWCLPHTGNRHN
  • SKIVVEFLQ
  • RMGYQCTFG
  • GNAVPPPLA
  • FSGCGGL
  • LLKLVMAGE
  • KFYRPENTH
  • RTITVRDTMSDLP
  • LDDPDLK
  • YIKGSNLDAP
  • GGPPCQG
  • PGSDWRDLPNI
  • YSKFKNSL
  • FPEPLHVFAPRACQLSVVVDDKKFVSNITR
  • YQPILRDHICKDMS

Post-translational modifications for DNMT1 Gene

  • Sumoylated; sumoylation increases activity.
  • Acetylation on multiple lysines, mainly by KAT2B/PCAF, regulates cell cycle G(2)/M transition. Deacetylation of Lys-1349 and Lys-1415 by SIRT1 increases methyltransferase activity.
  • Phosphorylation of Ser-154 by CDKs is important for enzymatic activity and protein stability. Phosphorylation of Ser-143 by AKT1 prevents methylation by SETD7 therebye increasing DNMT1 stability.
  • Methylation at Lys-142 by SETD7 promotes DNMT1 proteasomal degradation.
  • Ubiquitinated by UHRF1; interaction with USP7 counteracts ubiquitination by UHRF1 by promoting deubiquitination and preventing degradation by the proteasome.
  • Ubiquitination at Lys58, Lys88, Lys134, Lys586, Lys666, Lys928, Lys961, Lys981, Lys997, Lys1323, Lys1415, Lys1483, and Lys1572
  • Modification sites at PhosphoSitePlus

Antibodies for research

  • Abcam antibodies for DNMT1

Domains & Families for DNMT1 Gene

Gene Families for DNMT1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • FDA approved drug targets
  • Plasma proteins
  • Predicted intracellular proteins
  • Transcription factors

Protein Domains for DNMT1 Gene

InterPro:
Blocks:
  • Bromo adjacent region
  • C-5 cytosine-specific DNA methylase
  • Zn-finger, CXXC type
  • DMAP1-binding

Suggested Antigen Peptide Sequences for DNMT1 Gene

GenScript: Design optimal peptide antigens:
  • MCMT (DNMT1_HUMAN)
  • Cytosine-specific methyltransferase (F5GX68_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P26358

UniProtKB/Swiss-Prot:

DNMT1_HUMAN :
  • The N-terminal part is required for homodimerization and acts as a regulatory domain.
  • Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family.
Domain:
  • The N-terminal part is required for homodimerization and acts as a regulatory domain.
  • The CXXC-type zinc finger specifically binds to unmethylated CpG dinucleotides, positioning the autoinhibitory linker between the DNA and the active site, thus providing a mechanism to ensure that only hemimethylated CpG dinucleotides undergo methylation.
Family:
  • Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family.
genes like me logo Genes that share domains with DNMT1: view

Function for DNMT1 Gene

Molecular function for DNMT1 Gene

UniProtKB/Swiss-Prot Function:
Methylates CpG residues. Preferentially methylates hemimethylated DNA. Associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance. Associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones. Mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. Probably forms a corepressor complex required for activated KRAS-mediated promoter hypermethylation and transcriptional silencing of tumor suppressor genes (TSGs) or other tumor-related genes in colorectal cancer (CRC) cells (PubMed:24623306). Also required to maintain a transcriptionally repressive state of genes in undifferentiated embryonic stem cells (ESCs) (PubMed:24623306). Associates at promoter regions of tumor suppressor genes (TSGs) leading to their gene silencing (PubMed:24623306). Promotes tumor growth (PubMed:24623306).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a 2'-deoxycytidine in DNA + S-adenosyl-L-methionine = a 5-methyl-2'-deoxycytidine in DNA + H(+) + S-adenosyl-L-homocysteine; Xref=Rhea:RHEA:13681, Rhea:RHEA-COMP:11369, Rhea:RHEA-COMP:11370, ChEBI:CHEBI:15378, ChEBI:CHEBI:57856, ChEBI:CHEBI:59789, ChEBI:CHEBI:85452, ChEBI:CHEBI:85454; EC=2.1.1.37; Evidence={ECO:0000255|PROSITE-ProRule:PRU10018};.
UniProtKB/Swiss-Prot Induction:
Its abundance is reduced to non detectable levels at the G0 phase of the cell cycle and is dramatically induced upon entrance into the S-phase of the cell cycle.
GENATLAS Biochemistry:
DNA methyltransferase,1 (5-methyl-cytosine),constitutively expressed, with two alternatively spliced isoforms,a long form abundantly expressed in several tissues and cell lines and a short form,mainly involved in the maintenance of DNA-methylation activities,also associating with HDAC1,acting as a putative mediator of the methylation process

Enzyme Numbers (IUBMB) for DNMT1 Gene

Phenotypes From GWAS Catalog for DNMT1 Gene

Gene Ontology (GO) - Molecular Function for DNMT1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003677 DNA binding IEA,IDA 18754681
GO:0003682 chromatin binding IEA --
GO:0003723 RNA binding IDA --
GO:0003886 DNA (cytosine-5-)-methyltransferase activity IEA,IDA 21745816
GO:0005515 protein binding IPI 16357870
genes like me logo Genes that share ontologies with DNMT1: view
genes like me logo Genes that share phenotypes with DNMT1: view

Human Phenotype Ontology for DNMT1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for DNMT1 Gene

MGI Knock Outs for DNMT1:

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DNMT1

Clone products for research

  • Addgene plasmids for DNMT1

No data available for Transcription Factor Targets and HOMER Transcription for DNMT1 Gene

Localization for DNMT1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DNMT1 Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DNMT1 gene
Compartment Confidence
nucleus 5
extracellular 3
mitochondrion 3
cytosol 3
plasma membrane 2
cytoskeleton 2
endoplasmic reticulum 2
lysosome 2
peroxisome 1
endosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for DNMT1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000792 heterochromatin IDA --
GO:0005634 nucleus IEA,IBA 21873635
GO:0005654 nucleoplasm TAS --
GO:0005657 replication fork IDA --
GO:0005721 pericentric heterochromatin IDA --
genes like me logo Genes that share ontologies with DNMT1: view

Pathways & Interactions for DNMT1 Gene

genes like me logo Genes that share pathways with DNMT1: view

Pathways by source for DNMT1 Gene

1 GeneGo (Thomson Reuters) pathway for DNMT1 Gene
  • Methionine metabolism
1 Qiagen pathway for DNMT1 Gene
  • DNA Methylation and Transcriptional Repression
1 Cell Signaling Technology pathway for DNMT1 Gene

SIGNOR curated interactions for DNMT1 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for DNMT1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription by RNA polymerase II IDA,TAS 10888872
GO:0006306 DNA methylation IDA,TAS 10888872
GO:0006325 chromatin organization IEA --
GO:0007265 Ras protein signal transduction IMP 24623306
GO:0010216 maintenance of DNA methylation IMP,IDA 18754681
genes like me logo Genes that share ontologies with DNMT1: view

Drugs & Compounds for DNMT1 Gene

(62) Drugs for DNMT1 Gene - From: DrugBank, ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Decitabine Approved, Investigational Pharma Target, inhibitor DNA methyltransferase inhibitor 416
Azacitidine Approved, Investigational Pharma Target, inhibitor 613
Procainamide Approved Pharma Target, other 15
Flucytosine Approved, Investigational Pharma Target, other 39
Procaine Approved, Investigational, Vet_approved Pharma Target, inhibitor 52

(46) Additional Compounds for DNMT1 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
s-adenosylmethionine
  • (3S)-5'-[(3-Amino-3-carboxypropyl)methylsulfonio]-5'-deoxyadenosine, inner salt
  • [1-(Adenin-9-yl)-1,5-dideoxy-beta-D-ribofuranos-5-yl][(3S)-3-amino-3-carboxypropyl](methyl)sulfonium
  • Acylcarnitine
  • AdoMet
  • S-(5'-Deoxyadenosin-5'-yl)-L-methionine
485-80-3

(5) Tocris Compounds for DNMT1 Gene

Compound Action Cas Number
5-Azacytidine DNA methyltransferase inhibitor 320-67-2
Decitabine DNA methyltransferase inhibitor 2353-33-5
Lomeguatrib MGMT inhibitor 192441-08-0
RG 108 Non-nucleoside DNA methyltransferase inhibitor 48208-26-0
Zebularine DNA methyltransferase and cytidine deaminase inhibitor 3690-10-6

(7) ApexBio Compounds for DNMT1 Gene

Compound Action Cas Number
5-Azacytidine DNA methyltransferase inhibitor. 320-67-2
Decitabine (NSC127716, 5AZA-CdR) Deoxycytidine analog and cellular diifferentiation inducer 2353-33-5
Lomeguatrib MGMT inhibitor 192441-08-0
RG 108 DNA methyltransferase inhibitor 48208-26-0
SGI-1027 DNMT inhibitor 1020149-73-8
Thioguanine Purine antimetabolite 154-42-7
Zebularine DNA methylation inhibitor 3690-10-6
genes like me logo Genes that share compounds with DNMT1: view

Drug products for research

Transcripts for DNMT1 Gene

mRNA/cDNA for DNMT1 Gene

4 REFSEQ mRNAs :
12 NCBI additional mRNA sequence :
52 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DNMT1

Clone products for research

  • Addgene plasmids for DNMT1

Alternative Splicing Database (ASD) splice patterns (SP) for DNMT1 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6a · 6b ^ 7 ^ 8 ^ 9 ^ 10 ^ 11a · 11b ^ 12a · 12b ^ 13a · 13b ^ 14a · 14b ^ 15a · 15b ^ 16 ^ 17a · 17b · 17c ^ 18 ^
SP1:
SP2:
SP3: -
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10: -
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:
SP18:
SP19:
SP20:
SP21:
SP22:
SP23:

ExUns: 19a · 19b ^ 20 ^ 21a · 21b ^ 22a · 22b · 22c ^ 23 ^ 24 ^ 25 ^ 26a · 26b · 26c · 26d ^ 27a · 27b · 27c ^ 28a · 28b · 28c ^ 29 ^ 30 ^ 31 ^ 32a · 32b ^
SP1: - - - - -
SP2:
SP3:
SP4:
SP5:
SP6: -
SP7: - - - - - -
SP8:
SP9:
SP10:
SP11:
SP12: - -
SP13: - - - -
SP14: - - - -
SP15:
SP16:
SP17: - -
SP18: - -
SP19:
SP20:
SP21:
SP22:
SP23:

ExUns: 33a · 33b · 33c · 33d ^ 34 ^ 35a · 35b ^ 36 ^ 37 ^ 38
SP1: - - -
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16: - -
SP17:
SP18:
SP19:
SP20: -
SP21:
SP22:
SP23: - - -

Relevant External Links for DNMT1 Gene

GeneLoc Exon Structure for
DNMT1

Expression for DNMT1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for DNMT1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for DNMT1 Gene

This gene is overexpressed in Nasal epithelium (10.3), Bone marrow mesenchymal stem cell (8.4), Lymph node (7.6), and Peripheral blood mononuclear cells (7.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for DNMT1 Gene



Protein tissue co-expression partners for DNMT1 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for DNMT1

SOURCE GeneReport for Unigene cluster for DNMT1 Gene:

Hs.202672

mRNA Expression by UniProt/SwissProt for DNMT1 Gene:

P26358-DNMT1_HUMAN
Tissue specificity: Ubiquitous; highly expressed in fetal tissues, heart, kidney, placenta, peripheral blood mononuclear cells, and expressed at lower levels in spleen, lung, brain, small intestine, colon, liver, and skeletal muscle. Isoform 2 is less expressed than isoform 1.

Evidence on tissue expression from TISSUES for DNMT1 Gene

  • Liver(4.6)
  • Nervous system(4.3)
  • Intestine(3.3)
  • Bone marrow(3.3)
  • Lymph node(3.2)
  • Blood(3)
  • Skin(3)
  • Lung(2.8)
  • Heart(2.7)
  • Kidney(2.7)
  • Spleen(2.7)
  • Stomach(2.6)
  • Muscle(2.6)
  • Pancreas(2.4)
  • Adrenal gland(2.3)
  • Thyroid gland(2.2)
  • Eye(2.2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for DNMT1 Gene

Germ Layers:
  • ectoderm
  • mesoderm
Systems:
  • immune
  • lymphatic
  • nervous
  • skeletal muscle
  • skeleton
Regions:
Head and neck:
  • brain
  • cerebellum
  • head
  • jaw
  • mandible
  • maxilla
  • mouth
  • neck
  • skull
Thorax:
  • chest wall
  • clavicle
  • rib
  • rib cage
  • scapula
  • sternum
Pelvis:
  • pelvis
Limb:
  • ankle
  • arm
  • digit
  • elbow
  • femur
  • fibula
  • finger
  • foot
  • forearm
  • hand
  • hip
  • humerus
  • knee
  • lower limb
  • radius
  • shin
  • shoulder
  • thigh
  • tibia
  • toe
  • ulna
  • upper limb
  • wrist
General:
  • bone marrow
  • peripheral nerve
  • peripheral nervous system
  • spinal column
  • spinal cord
  • vertebrae
genes like me logo Genes that share expression patterns with DNMT1: view

Primer products for research

No data available for mRNA differential expression in normal tissues for DNMT1 Gene

Orthologs for DNMT1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for DNMT1 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia DNMT1 29 30
  • 99.37 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia DNMT1 29 30
  • 87.56 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia DNMT1 29 30
  • 86.55 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia -- 30
  • 83 (a)
OneToMany
-- 30
  • 43 (a)
OneToMany
Rat
(Rattus norvegicus)
Mammalia Dnmt1 29
  • 79.13 (n)
Mouse
(Mus musculus)
Mammalia Dnmt1 29 16 30
  • 78.77 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia DNMT1 30
  • 71 (a)
OneToOne
Chicken
(Gallus gallus)
Aves DNMT1 29 30
  • 75.16 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia DNMT1 30
  • 71 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia dnmt1 29
  • 70.64 (n)
Str.1757 29
Zebrafish
(Danio rerio)
Actinopterygii dnmt1 29 30
  • 68.1 (n)
OneToOne
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.1220 29
Thale Cress
(Arabidopsis thaliana)
eudicotyledons MET1 29
  • 47.82 (n)
Rice
(Oryza sativa)
Liliopsida Os03g0798300 29
  • 57.91 (n)
Os.30977 29
Barley
(Hordeum vulgare)
Liliopsida Hv.11558 29
Wheat
(Triticum aestivum)
Liliopsida Ta.9261 29
Corn
(Zea mays)
Liliopsida Zm.16993 29
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 30
  • 56 (a)
OneToOne
Sea Vase
(Ciona inte