Free for academic non-profit institutions. Other users need a Commercial license
This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Alternative splicing results in... See more...
Aliases for DICER1 Gene
Aliases for DICER1 Gene
External Ids for DICER1 Gene
- HGNC: 17098
- NCBI Entrez Gene: 23405
- Ensembl: ENSG00000100697
- OMIM®: 606241
- UniProtKB/Swiss-Prot: Q9UPY3
Previous HGNC Symbols for DICER1 Gene
- MNG1
Previous GeneCards Identifiers for DICER1 Gene
- GC14M093065
- GC14M089372
- GC14M093542
- GC14M094622
- GC14M095552
- GC14M075736
Summaries for DICER1 Gene
-
This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2010]
GeneCards Summary for DICER1 Gene
DICER1 (Dicer 1, Ribonuclease III) is a Protein Coding gene. Diseases associated with DICER1 include Global Developmental Delay, Lung Cysts, Overgrowth, And Wilms Tumor and Pleuropulmonary Blastoma. Among its related pathways are Tat-mediated elongation of the HIV-1 transcript and Mitotic Prophase. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and hydrolase activity.
UniProtKB/Swiss-Prot Summary for DICER1 Gene
-
Double-stranded RNA (dsRNA) endoribonuclease playing a central role in short dsRNA-mediated post-transcriptional gene silencing. Cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation. Gene silencing mediated by siRNAs, also called RNA interference, controls the elimination of transcripts from mobile and repetitive DNA elements of the genome but also the degradation of exogenous RNA of viral origin for instance. The miRNA pathway on the other side is a mean to specifically regulate the expression of target genes.
Additional gene information for DICER1 Gene
- HGNC (17098)
- NCBI Entrez Gene (23405)
- Ensembl (ENSG00000100697)
- OMIM® (606241)
- UniProtKB/Swiss-Prot (Q9UPY3)
- Open Targets Platform(ENSG00000100697)
- Monarch Initiative
- Alliance of Genome Resources
- Search for DICER1 at DataMed
- Search for DICER1 at HumanCyc
No data available for Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for DICER1 Gene
Genomics for DICER1 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for DICER1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around DICER1 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for DICER1
- Top Transcription factor binding sites by QIAGEN in the DICER1 gene promoter:
-
- AP-1
- ATF-2
- c-Jun
Genomic Locations for DICER1 Gene
Latest Assembly
- chr14:95,086,228-95,158,263
- (GRCh38/hg38)
- Size:
- 72,036 bases
- Orientation:
- Minus strand
Previous Assembly
- chr14:95,552,565-95,624,347
- (GRCh37/hg19 by Entrez Gene)
- Size:
- 71,783 bases
- Orientation:
- Minus strand
Genomic View for DICER1 Gene
Genes around DICER1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 14q32.13 by HGNC
- 14q32.13 by Entrez Gene
- 14q32.13 by Ensembl
DICER1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for DICER1 Gene
Proteins for DICER1 Gene
-
Protein details for DICER1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9UPY3-DICER_HUMAN
- Recommended name:
- Endoribonuclease Dicer
- Protein Accession:
- Q9UPY3
- A7E2D3
- B3KRG4
- E0AD28
- O95943
- Q9UQ02
Protein attributes for DICER1 Gene
- Size:
- 1922 amino acids
- Molecular mass:
- 218682 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Cofactor:
- Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Quaternary structure:
-
- Component of the RISC loading complex (RLC), or micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2; DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. Note that the trimeric RLC/miRLC is also referred to as RISC. Interacts with DHX9, AGO1, PIWIL1 and PRKRA. Associates with the 60S ribosome. Interacts with BCDIN3D. Interacts with AGO2, TARBP2, EIF6, MOV10 and RPL7A (60S ribosome subunit); they form a large RNA-induced silencing complex (RISC) (PubMed:17507929). Interacts (via Dicer dsRNA-binding fold domain) with ALOX5 (via PLAT domain); this interaction enhances arachidonate 5-lipoxygenase activity and modifies the miRNA precursor processing activity of DICER1 (PubMed:19022417).
- (Microbial infection) Interacts with ebolavirus transcriptional activator VP30; this interaction prevents TARBP2/TRBP binding to DICER1 and thus allows the virus to counteract host RNA silencing.
- (Microbial infection) Interacts with ebolavirus transcriptional activator VP35; this interaction prevents TARBP2/TRBP binding to DICER1 and thus allows the virus to counteract host RNA silencing.
- SequenceCaution:
-
- Sequence=CAB38857.2; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};
Three dimensional structures from OCA and Proteopedia for DICER1 Gene
Protein Expression for DICER1 Gene
Selected DME Specific Peptides for DICER1 Gene
- Q9UPY3:
-
- QQVSAVRTH
- NRYCARLPSDPFTHLAPKC
- EDIEKSEAR
- IPHFPVYTRSGEVTISIEL
- PASLWRKAVCLPSILYRLHCLLTAEELRAQTA
- RSYVQSKGRAR
- DLTAINGLSYN
- DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNR
- LTDLRSA
- EEDIEVPKAMGDIFES
- EEDDFVVGFWNPSEENCG
- VSNCNLYRLGKK
- GKVRVTVEVV
- LKIPPRCMF
- LELITRLHQYIFSHILRLEKPALEFKP
- ECTLLSN
- PKAIPECLR
- LVVRFDLP
- VLGPWCADK
- LEEKIQKLE
- DFRYPNLDFGWK
- CPRILGLTASILNGKCDP
- PLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKV
- QPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFG
- GSGKTFIAVLL
- NRDFCQGN
- INLLVFDECHLAI
- LRKIHALCEE
- YRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKT
- PKCNLVVR
- RLEFLGDA
- TPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAA
- EDLKTYKAIEKILRNKCSKS
- DKSIADCVEAL
- RKFLLFTDT
- FKLEDYQDAVIIPR
- HPYREIMK
- HSKERDSTLISKQILSDC
- VWQVYYPMM
- INYRFKN
- FDYSSWDAMCYLDPSKA
- HLYEDPRQHSPG
- PSRMVVSIFDPPVNWLPPGY
- GYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFL
- STLYLPINSPLRA
- FEKKINY
- KQILVPELC
- DLKVGEYS
- TLDIDFKF
- QRLEFLGD
- DQMSVNC
- QPLLDVDHTS
Post-translational modifications for DICER1 Gene
Other Protein References for DICER1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibodies for research
- LifeSpan BioSciences DICER1 / Dicer Antibody
- G Biosciences Immunotag™ DICER Polyclonal Antibody and Immunotag™ Dicer Antibody
- NSJ Bioreagents Dicer Antibody
- GeneTex Anti-Dicer antibody and Anti-Dicer antibody [GT1176]
- Novus Biologicals Antibodies for DICER1
-
Abcam antibodies for DICER1
- Invitrogen Antibodies for DICER1 (AFLGC-DICER1)
- antibodies-online: Show 56 available DICER1 Antibodies ranked by validation data
- Compare Top DICER1 Antibodies
-
Recommended
- 127 WB Antibodies (anti-mouse)
- 12 IF (p) Antibodies (anti-mouse)
- 3 IF Antibodies (anti-mouse)
- 3 IHC (fro) Antibodies (anti-mouse)
- 3 IHC Antibodies (anti-mouse)
- 3 IHC (p) Antibodies (anti-mouse)
- 135 WB Antibodies (anti-human)
- 13 IHC (p) Antibodies (anti-human)
- 12 IF (p) Antibodies (anti-human)
- 8 IHC Antibodies (anti-human)
- 3 IHC (fro) Antibodies (anti-human)
- 67 WB Antibodies (anti-rat)
- 12 IF (p) Antibodies (anti-rat)
-
Biorbyt antibodies for DICER1
-
Custom Antibody ServicesProSci Antibodies for DICER1
-
Santa Cruz Biotechnology (SCBT) Antibodies for DICER1
Protein products for research
- Search Origene for MassSpec and Protein Over-expression Lysates for DICER1
- Origene Custom Protein Services for DICER1
-
Abcam proteins for DICER1
Assay products for research
Domains & Families for DICER1 Gene
Gene Families for DICER1 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Cancer-related genes
- Disease related genes
- Enzymes
- Plasma proteins
- Potential drug targets
- Predicted intracellular proteins
Protein Domains for DICER1 Gene
- InterPro:
- Blocks:
-
- Argonaute and Dicer protein, PAZ
- Double-stranded RNA binding (DsRBD) domain
- Ribonuclease III family
- Protein of unknown function DUF283
Suggested Antigen Peptide Sequences for DICER1 Gene
- GenScript: Design optimal peptide antigens:
-
- Helicase with RNase motif (DICER_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q9UPY3- Family:
-
- Belongs to the helicase family. Dicer subfamily.
Function for DICER1 Gene
Molecular function for DICER1 Gene
- UniProtKB/Swiss-Prot Function:
- Double-stranded RNA (dsRNA) endoribonuclease playing a central role in short dsRNA-mediated post-transcriptional gene silencing. Cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation. Gene silencing mediated by siRNAs, also called RNA interference, controls the elimination of transcripts from mobile and repetitive DNA elements of the genome but also the degradation of exogenous RNA of viral origin for instance. The miRNA pathway on the other side is a mean to specifically regulate the expression of target genes.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=Endonucleolytic cleavage to 5'-phosphomonoester.; EC=3.1.26.3; Evidence={ECO:0000269|PubMed:15242644, ECO:0000269|PubMed:17920623};.
Enzyme Numbers (IUBMB) for DICER1 Gene
Phenotypes From GWAS Catalog for DICER1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0003677 | DNA binding | IEA | -- |
| GO:0003723 | RNA binding | IEA,IBA | 21873635 |
| GO:0003725 | double-stranded RNA binding | IMP | 19701182 |
| GO:0004386 | helicase activity | IEA | -- |
Phenotypes for DICER1 Gene
- MGI mutant phenotypes for DICER1:
-
inferred from 23 alleles
- normal phenotype
- nervous system phenotype
- muscle phenotype
- homeostasis/metabolism phenotype
- growth/size/body region phenotype
- cellular phenotype
- cardiovascular system phenotype
- behavior/neurological phenotype
- immune system phenotype
- respiratory system phenotype
- mortality/aging
- renal/urinary system phenotype
- liver/biliary system phenotype
- hematopoietic system phenotype
- neoplasm
- endocrine/exocrine gland phenotype
- reproductive system phenotype
- vision/eye phenotype
- limbs/digits/tail phenotype
- skeleton phenotype
- integument phenotype
- embryo phenotype
- craniofacial phenotype
- no phenotypic analysis
- GenomeRNAi human phenotypes for DICER1:
-
- Strongly decreased CFP-tsO45G cell surface transport
- Decreased NF-kappaB reporter expression
- shRNA abundance <= 25%
- Reduced mammosphere formation
- no effect
- Decreased vaccinia virus (VACV) infection
- Decreased ionizing radiation sensitivity
- Increased shRNA abundance (Z-score > 2)
- Synthetic lethal with Ras
- Decreased shRNA abundance (Z-score < -2)
Animal Models for DICER1 Gene
Animal Models for research
-
Taconic Biosciences Mouse Models for DICER1
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for DICER1 - Starting at $85 >
- * DICER1 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for DICER1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for DICER1
-
Santa Cruz Biotechnology (SCBT) CRISPR for DICER1
miRNA for DICER1 Gene
- miRTarBase miRNAs that target DICER1
-
- hsa-let-7a-5p (MIRT004346)
- hsa-let-7d-5p (MIRT004347)
- hsa-let-7c-5p (MIRT004348)
- hsa-let-7b-5p (MIRT005322)
- hsa-miR-103a-3p (MIRT005347)
- hsa-miR-107 (MIRT005348)
- hsa-miR-519a-3p (MIRT005571)
- hsa-miR-374a-5p (MIRT005572)
- hsa-miR-154-5p (MIRT005679)
- hsa-miR-130a-3p (MIRT006258)
- hsa-miR-221-3p (MIRT006376)
- hsa-miR-222-3p (MIRT006377)
- hsa-miR-29a-3p (MIRT006379)
- hsa-miR-18a-5p (MIRT007178)
- hsa-miR-130b-3p (MIRT007384)
- mmu-miR-541-5p (MIRT008132)
- mmu-miR-181a-5p (MIRT014028)
- mmu-miR-136-5p (MIRT014878)
- hsa-miR-425-5p (MIRT016677)
- hsa-miR-29c-3p (MIRT020398)
- hsa-miR-215-5p (MIRT024517)
- hsa-miR-192-5p (MIRT026884)
- hsa-miR-98-5p (MIRT027858)
- hsa-miR-296-3p (MIRT038408)
- hsa-miR-16-5p (MIRT051245)
- hsa-miR-3928-3p (MIRT053189)
- hsa-miR-497-5p (MIRT053193)
- hsa-miR-195-5p (MIRT053194)
- hsa-miR-9-5p (MIRT054042)
- hsa-miR-581 (MIRT054786)
- hsa-miR-513a-3p (MIRT071643)
- hsa-miR-513c-3p (MIRT071645)
- hsa-miR-3606-3p (MIRT071646)
- hsa-miR-106a-3p (MIRT071648)
- hsa-miR-4282 (MIRT114873)
- hsa-miR-1263 (MIRT139578)
- hsa-miR-376a-5p (MIRT139613)
- hsa-miR-586 (MIRT280522)
- hsa-miR-382-5p (MIRT440814)
- hsa-miR-218-5p (MIRT440815)
- hsa-miR-377-5p (MIRT440816)
- hsa-miR-21-5p (MIRT440817)
- hsa-miR-6800-5p (MIRT478128)
- hsa-miR-498 (MIRT485634)
- hsa-miR-548aw (MIRT485635)
- hsa-miR-582-5p (MIRT485636)
- hsa-miR-1468-3p (MIRT485637)
- hsa-miR-548x-5p (MIRT485638)
- hsa-miR-548g-5p (MIRT485639)
- hsa-miR-548f-5p (MIRT485640)
- hsa-miR-548aj-5p (MIRT485641)
- hsa-miR-3613-3p (MIRT485642)
- hsa-miR-101-3p (MIRT485643)
- hsa-miR-148b-3p (MIRT485644)
- hsa-miR-148a-3p (MIRT485645)
- hsa-miR-152-3p (MIRT485646)
- hsa-miR-454-3p (MIRT485647)
- hsa-miR-301b-3p (MIRT485648)
- hsa-miR-3666 (MIRT485649)
- hsa-miR-301a-3p (MIRT485650)
- hsa-miR-4295 (MIRT485651)
- hsa-miR-19b-3p (MIRT485652)
- hsa-miR-19a-3p (MIRT485653)
- hsa-miR-5701 (MIRT558374)
- hsa-miR-8069 (MIRT558375)
- hsa-miR-1184 (MIRT558376)
- hsa-miR-3607-5p (MIRT558377)
- hsa-miR-4705 (MIRT558378)
- mmu-miR-5126 (MIRT583963)
- mmu-miR-466q (MIRT600979)
- hsa-miR-7157-3p (MIRT630699)
- hsa-miR-6737-3p (MIRT630700)
- hsa-miR-5008-3p (MIRT630701)
- hsa-miR-6889-3p (MIRT630702)
- hsa-miR-519c-3p (MIRT630703)
- hsa-miR-519b-3p (MIRT630704)
- hsa-miR-15a-5p (MIRT727876)
- hsa-miR-15b-5p (MIRT727877)
- cgr-miR-29b-3p (MIRT733804)
- mmu-miR-124-5p (MIRT733827)
- hsa-miR-31-3p (MIRT734964)
- hsa-miR-200a-3p (MIRT734965)
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DICER1
- Browse OriGene Inhibitory RNA Products For DICER1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DICER1
Clone products for research
- Applied Biological Materials (abm): Clones for DICER1 - Starting at $45 >
- * DICER1 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for DICER1
- Addgene plasmids for DICER1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for DICER1
Cell Lines for research
No data available for Transcription Factor Targets and HOMER Transcription for DICER1 Gene
Localization for DICER1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for DICER1 Gene
- Cytoplasm. Cytoplasm, perinuclear region.
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| nucleus | 5 |
| cytosol | 5 |
| cytoskeleton | 3 |
| plasma membrane | 2 |
| mitochondrion | 2 |
| peroxisome | 2 |
| endoplasmic reticulum | 2 |
| endosome | 2 |
| lysosome | 2 |
| golgi apparatus | 2 |
- Cytosol (3)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IBA | 21873635 |
| GO:0005737 | cytoplasm | IBA | 21873635 |
| GO:0005793 | endoplasmic reticulum-Golgi intermediate compartment | IEA | -- |
| GO:0005829 | cytosol | TAS | -- |
| GO:0016442 | NOT RISC complex | IBA,IDA | 16357216 |
Pathways & Interactions for DICER1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Mitotic Prophase | ||
| 2 | Tat-mediated elongation of the HIV-1 transcript |
.01
|
|
| 3 | Translational Control | ||
| 4 | MicroRNAs in cancer | ||
| 5 | RNAi Pathway |
RNAi Pathway
-
|
|
Pathways by source for DICER1 Gene
4 BioSystems pathways for DICER1 Gene
4 Reactome pathways for DICER1 Gene
1 KEGG pathway for DICER1 Gene
1 Qiagen pathway for DICER1 Gene
- RNAi Pathway
1 Cell Signaling Technology pathway for DICER1 Gene
Interacting Proteins for DICER1 Gene
Selected Interacting proteins:
Q9UPY3-DICER_HUMAN
ENSP00000437256
for DICER1 Gene via
UniProtKB
MINT
STRING
IID
GPS-Prot Interaction Network for DICER1
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000122 | negative regulation of transcription by RNA polymerase II | ISS | -- |
| GO:0006309 | apoptotic DNA fragmentation | IBA | 21873635 |
| GO:0006396 | RNA processing | IEA | -- |
| GO:0010586 | miRNA metabolic process | TAS | -- |
| GO:0010626 | negative regulation of Schwann cell proliferation | ISS | -- |
Drugs & Compounds for DICER1 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Cyclophosphamide | Approved, Investigational | Pharma | Nitrogen mustard alkylating agent and prodrug. | 3864 | ||
| Dactinomycin | Approved, Investigational | Pharma | 56 | |||
| Doxorubicin | Approved, Investigational | Pharma | Topo II inhibitor,immunosuppresive antineoplastic antibiotic | 2106 | ||
| Ifosfamide | Approved | Pharma | Cytostatic agent | 465 | ||
| Vincristine | Approved, Investigational | Pharma | Microtubule disrupter,antitumor agent | 1112 |
Transcripts for DICER1 Gene
mRNA/cDNA for DICER1 Gene
- 5 REFSEQ mRNAs :
- 26 NCBI additional mRNA sequence :
- 17 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000343455 10384 nts (view in UCSC)
- ENST00000393063 7423 nts (view in UCSC)
- ENST00000526495 10315 nts (view in UCSC)
- ENST00000527414 6179 nts (view in UCSC)
- ENST00000527416 691 nts (view in UCSC)
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for DICER1 - Starting at $85 >
- * DICER1 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for DICER1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for DICER1
-
Santa Cruz Biotechnology (SCBT) CRISPR for DICER1
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DICER1
- Browse OriGene Inhibitory RNA Products For DICER1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DICER1
Clone products for research
- Applied Biological Materials (abm): Clones for DICER1 - Starting at $45 >
- * DICER1 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for DICER1
- Addgene plasmids for DICER1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for DICER1
| ExUns: | 1a | · | 1b | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5 | ^ | 6 | ^ | 7 | ^ | 8a | · | 8b | ^ | 9 | ^ | 10a | · | 10b | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | ^ | 14 | ^ | 15a | · | 15b | ^ | 16 | ^ | 17a | · | 17b | ^ | 18 | ^ | 19a | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP9: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP10: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP11: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP12: |
| ExUns: | 19b | ^ | 20 | ^ | 21 | ^ | 22 | ^ | 23a | · | 23b | ^ | 24 | ^ | 25 | ^ | 26a | · | 26b | · | 26c | ^ | 27 | ^ | 28a | · | 28b | ^ | 29 | ^ | 30a | · | 30b | ^ | 31a | · | 31b | ^ | 32 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | |||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | |||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | |||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | |||||||||||||||||||||||||||||||||||
| SP5: | |||||||||||||||||||||||||||||||||||||||
| SP6: | |||||||||||||||||||||||||||||||||||||||
| SP7: | |||||||||||||||||||||||||||||||||||||||
| SP8: | |||||||||||||||||||||||||||||||||||||||
| SP9: | |||||||||||||||||||||||||||||||||||||||
| SP10: | |||||||||||||||||||||||||||||||||||||||
| SP11: | |||||||||||||||||||||||||||||||||||||||
| SP12: |
Relevant External Links for DICER1 Gene
- GeneLoc Exon Structure for
- DICER1
Expression for DICER1 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
This gene is overexpressed in Placenta (10.0), Pancreatic juice (9.5), Fetal Brain (6.8), and Lung (6.4).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for DICER1 Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for DICER1
SOURCE GeneReport for Unigene cluster for DICER1 Gene:
Hs.87889Evidence on tissue expression from TISSUES for DICER1 Gene
- Nervous system(4.9)
- Liver(4.7)
- Lung(4.6)
- Kidney(3.2)
- Intestine(3.1)
- Heart(3.1)
- Muscle(3)
- Spleen(3)
- Skin(3)
- Blood(3)
- Eye(3)
- Lymph node(2.7)
- Bone marrow(2.6)
- Thyroid gland(2.6)
- Pancreas(2.4)
- Stomach(2.4)
- Adrenal gland(2.1)
Phenotype-based relationships between genes and organs from Gene ORGANizer for DICER1 Gene
Germ Layers:
- ectoderm
- endoderm
- mesoderm
Systems:
- cardiovascular
- digestive
- endocrine
- integumentary
- nervous
- reproductive
- respiratory
- skeletal muscle
- skeleton
- urinary
Regions:
Head and neck:
- brain
- cerebellum
- ear
- eye
- head
- hypothalamus
- jaw
- mandible
- maxilla
- mouth
- neck
- pituitary gland
- skull
- thyroid
Thorax:
- chest wall
- clavicle
- heart
- lung
- rib
- rib cage
- scapula
- sternum
Abdomen:
- adrenal gland
- intestine
- kidney
- large intestine
- small intestine
Pelvis:
- pelvis
- uterus
Limb:
- ankle
- arm
- digit
- elbow
- femur
- fibula
- finger
- foot
- forearm
- hand
- hip
- humerus
- knee
- lower limb
- radius
- shin
- shoulder
- thigh
- tibia
- toe
- ulna
- upper limb
- wrist
General:
- blood
- coagulation system
- peripheral nerve
- peripheral nervous system
- red blood cell
- skin
- spinal column
- vertebrae
Primer products for research
-
OriGene qPCR primer pairs for DICER1
Gene Expression Assays for research
No data available for mRNA differential expression in normal tissues and mRNA Expression by UniProt/SwissProt for DICER1 Gene
Orthologs for DICER1 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | DICER1 29 30 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | DICER1 29 30 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | DICER1 30 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | DICER1 30 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | DICER1 29 30 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Dicer1 29 |
|
||
| Mouse (Mus musculus) |
Mammalia | Dicer1 29 16 30 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | DICER1 29 30 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | DICER1 30 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | dicer1 29 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | dicer1 29 30 |
|
OneToOne | |
| wufc39d11 29 |
|
||||
| Fruit Fly (Drosophila melanogaster) |
Insecta | Dcr-1 29 30 31 |
|
OneToOne | |
| Dcr-2 31 |
|
|
|||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP002836 29 |
|
||
| Worm (Caenorhabditis elegans) |
Secernentea | dcr-1 29 30 31 |
|
OneToOne | |
| Sea Squirt (Ciona savignyi) |
Ascidiacea | -- 30 |
|
OneToOne | |
| Fission Yeast (Schizosaccharomyces pombe) |
Schizosaccharomycetes | dcr1 29 |
|
||
| Bread mold (Neurospora crassa) |
Ascomycetes | NCU08270 29 |
|
||
| Sea Vase (Ciona intestinalis) |
Ascidiacea | Cin.14057 29 |
|
- Species where no ortholog for DICER1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for DICER1 Gene
- ENSEMBL:
- Gene Tree for DICER1 (if available)
- TreeFam:
- Gene Tree for DICER1 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for DICER1: view image
- Alliance of Genome Resources:
- Additional Orthologs for DICER1
Paralogs for DICER1 Gene
(1) SIMAP similar genes for DICER1 Gene using alignment to 4 proteins:
- DICER_HUMAN
- B3KRG4_HUMAN
- H0YJZ6_HUMAN
- Q5D0K5_HUMAN
Pseudogenes.org Pseudogenes for DICER1 Gene
No data available for Paralogs for DICER1 Gene
Variants for DICER1 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for DICER1 Gene
| SNP ID | Clinical significance and condition | Chr 14 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| 1000187 | Uncertain Significance: DICER1-related pleuropulmonary blastoma cancer predisposition syndrome | 95,126,656(-) |
T/C NM_177438.3(DICER1):c.827A>G (p.Glu276Gly) |
MISSENSE | |
| 1000249 | Uncertain Significance: DICER1-related pleuropulmonary blastoma cancer predisposition syndrome | 95,096,506(-) |
A/C NM_177438.3(DICER1):c.4414T>G (p.Phe1472Val) |
MISSENSE | |
| 1000482 | Uncertain Significance: DICER1-related pleuropulmonary blastoma cancer predisposition syndrome | 95,096,195(-) |
C/A NM_177438.3(DICER1):c.4725G>T (p.Gly1575=) |
SYNONYMOUS | |
| 1000493 | Uncertain Significance: DICER1-related pleuropulmonary blastoma cancer predisposition syndrome | 95,104,092(-) |
T/A NM_177438.3(DICER1):c.3304A>T (p.Ile1102Phe) |
MISSENSE | |
| 1000667 | Uncertain Significance: DICER1-related pleuropulmonary blastoma cancer predisposition syndrome | 95,091,340(-) |
T/C NM_177438.3(DICER1):c.5390A>G (p.Glu1797Gly) |
MISSENSE_VARIANT,INTRON |
All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv3635396 | CNV | gain | 21293372 |
| nsv1036738 | CNV | gain | 25217958 |
| nsv471967 | CNV | novel sequence insertion | 20440878 |
| nsv84515 | CNV | deletion | 16902084 |
Residual Variation Intolerance Score:
1.88% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
2.69;
46.11% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for DICER1 Gene
SNP Genotyping and Copy Number Assays for research
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DICER1 Gene
Disorders for DICER1 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| global developmental delay, lung cysts, overgrowth, and wilms tumor |
|
|
| pleuropulmonary blastoma |
|
|
| goiter, multinodular 1, with or without sertoli-leydig cell tumors |
|
|
| rhabdomyosarcoma, embryonal, 2 |
|
|
| dicer1-related pleuropulmonary blastoma cancer predisposition syndrome |
|
Search DICER1 in MalaCards
View complete list of genes associated with diseases
UniProtKB/Swiss-Prot
DICER_HUMAN- Pleuropulmonary blastoma (PPB) [MIM:601200]: A rare pediatric intrathoracic neoplasm. The tumor arises from the lung, pleura, or both, and appears to be purely mesenchymal in phenotype. It lacks malignant epithelial elements, a feature that distinguishes it from the classic adult-type pulmonary blastoma. It arises during fetal lung development and is often part of an inherited cancer syndrome. The tumor contain both epithelial and mesenchymal cells. Early in tumorigenesis, cysts form in lung airspaces, and these cysts are lined with benign-appearing epithelium. Mesenchymal cells susceptible to malignant transformation reside within the cyst walls and form a dense layer beneath the epithelial lining. In a subset of patients, overgrowth of the mesenchymal cells produces a sarcoma, a transition that is associated with a poorer prognosis. Some patients have multilocular cystic nephroma, a benign kidney tumor. {ECO:0000269 PubMed:19556464}. Note=The disease is caused by variants affecting the gene represented in this entry.
- Goiter multinodular 1, with or without Sertoli-Leydig cell tumors (MNG1) [MIM:138800]: A common disorder characterized by nodular overgrowth of the thyroid gland. Some individuals may also develop Sertoli-Leydig cell tumors, usually of the ovary. {ECO:0000269 PubMed:21205968}. Note=The disease is caused by variants affecting the gene represented in this entry.
- Rhabdomyosarcoma, embryonal, 2 (RMSE2) [MIM:180295]: A form of rhabdomyosarcoma, a highly malignant tumor of striated muscle derived from primitive mesenchymal cells and exhibiting differentiation along rhabdomyoblastic lines. Rhabdomyosarcoma is one of the most frequently occurring soft tissue sarcomas and the most common in children. It occurs in four forms: alveolar, pleomorphic, embryonal and botryoidal rhabdomyosarcomas. {ECO:0000269 PubMed:21882293}. Note=The disease is caused by variants affecting the gene represented in this entry.
- Global developmental delay, lung cysts, overgrowth, and Wilms tumor (GLOW) [MIM:618272]: A disease characterized by the association of congenital nephromegaly, bilateral Wilms tumor, somatic overgrowth, developmental delay, macrocephaly, and bilateral lung cysts. {ECO:0000269 PubMed:24676357}. Note=The disease is caused by variants affecting the gene represented in this entry.
- Note=DICER1 mutations have been found in uterine cervix embryonal rhabdomyosarcoma, primitive neuroectodermal tumor, Wilms tumor, pulmonary sequestration and juvenile intestinal polyp (PubMed:21882293). Somatic missense mutations affecting the RNase IIIb domain of DICER1 are common in non-epithelial ovarian tumors. These mutations do not abolish DICER1 function but alter it in specific cell types, a novel mechanism through which perturbation of microRNA processing may be oncogenic (PubMed:22187960). {ECO:0000269 PubMed:21882293, ECO:0000269 PubMed:22187960}.
Additional Disease Information for DICER1
- Human Genome Epidemiology Navigator
- (HuGE)
- Atlas
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
- Open Targets Platform
No data available for Genatlas for DICER1 Gene
Publications for DICER1 Gene
- DICER1 mutations in familial multinodular goiter with and without ovarian Sertoli-Leydig cell tumors. (PMID: 21205968) Rio Frio T … Tischkowitz M (JAMA 2011) 2 3 4 72
- DICER1 mutations in familial pleuropulmonary blastoma. (PMID: 19556464) Hill DA … Goodfellow PJ (Science (New York, N.Y.) 2009) 3 4 22 72
- Expanding the phenotype of mutations in DICER1: mosaic missense mutations in the RNase IIIb domain of DICER1 cause GLOW syndrome. (PMID: 24676357) Klein S … Martinez-Agosto JA (Journal of medical genetics 2014) 3 4 72
- Extending the phenotypes associated with DICER1 mutations. (PMID: 21882293) Foulkes WD … Priest JR (Human mutation 2011) 3 4 72
- The role of PACT in the RNA silencing pathway. (PMID: 16424907) Lee Y … Kim VN (The EMBO journal 2006) 3 4 22
ExternalLinks
Products for DICER1 Gene
- Custom Antibody ServicesOriGene Antibodies for DICER1
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for DICER1
- Origene Custom Protein Services for DICER1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DICER1
- Browse OriGene Inhibitory RNA Products For DICER1
- OriGene qPCR primer pairs for DICER1
- OriGene CRISPR knockouts for DICER1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For DICER1
- Sino Biological Human cDNA Clone for DICER1
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for DICER1
- Novus Biologicals proteins and lysates for DICER1
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for DICER1
- Abcam proteins for DICER1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Taconic Biosciences Mouse Models for DICER1
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for DICER1 (AFLGC-DICER1)
- VectorBuilder Custom and pre-made DNA vectors for DICER1 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for DICER1 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for DICER1 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for DICER1 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for DICER1
- Addgene plasmids for DICER1
- antibodies-online: Show 56 available DICER1 Antibodies ranked by validation data
- Compare Top DICER1 Antibodies
- Recommended
- 127 WB Antibodies (anti-mouse)
- 12 IF (p) Antibodies (anti-mouse)
- 3 IF Antibodies (anti-mouse)
- 3 IHC (fro) Antibodies (anti-mouse)
- 3 IHC Antibodies (anti-mouse)
- 3 IHC (p) Antibodies (anti-mouse)
- 135 WB Antibodies (anti-human)
- 13 IHC (p) Antibodies (anti-human)
- 12 IF (p) Antibodies (anti-human)
- 8 IHC Antibodies (anti-human)
- 3 IHC (fro) Antibodies (anti-human)
- 67 WB Antibodies (anti-rat)
- 12 IF (p) Antibodies (anti-rat)
- antibodies-online: Show 16 available DICER1 Elisa Kits ranked by validation data
- Compare Top DICER1 Elisa Kits
- antibodies-online: Show 5 available DICER1 Proteins ranked by validation data
- Compare Top DICER1 Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for DICER1
- Search Santa Cruz Biotechnology (SCBT) for DICER1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for DICER1
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for DICER1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for DICER1
- Search GeneCopoeia for miRNA 3'UTR Target clone products for DICER1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DICER1
- Biorbyt antibodies for DICER1
Sources for DICER1 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM® (Updated: 05-Apr-2021)
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) ASD
- (27) SAGE
- (28) SOURCE
- (29) HomoloGene
- (30) PanEnsembl
- (31) euGenes
- (32) SGD
- (33) FlyBase
- (34) WormBase
- (35) Pseudogene
- (36) DGV
- (37) dbSNP
- (38) GenAtlas
- (39) HGMD
- (40) GAD
- (41) BGMUT
- (42) HuGE
- (43) Atlas
- (44) GenBank
- (45) HORDE
- (46) HUGE
- (47) IMGT
- (48) Leiden
- (49) miRBase
- (50) DME
- (51) OriGene
- (52) PubMed
- (53) R&D Systems
- (54) Tocris
- (55) Abcam
- (56) Novus Biologicals
- (57) ProSpec
- (58) Sino Biological
- (59) GenScript
- (60) Qiagen
- (61) OCA
- (62) Proteopedia
- (63) MOPED
- (64) neXtProt
- (65) Reactome
- (66) GeneGo (Thomson Reuters)
- (67) DISEASES
- (68) SIMAP
- (69) GenomeRNAi
- (70) LifeMap
- (71) miRTarBase
- (72) MalaCards
- (73) Invitrogen
- (74) BitterDB
- (75) ESI-BIO
- (76) RefSeq
- (77) BioSystems
- (78) MaxQB
- (79) IUPHAR
- (80) BioGPS
- (81) Illumina
- (82) COMPARTMENTS
- (83) HOMER
- (84) PaxDb
- (85) ApexBio
- (86) Addgene
- (87) antibodies-online
- (88) CYP
- (89) NONCODE
- (90) TreeFam
- (91) PathCards
- (92) GeneReviews
- (93) GeneTex
- (94) Taconic Biosciences
- (95) GTEx
- (96) ProteomicsDB
- (97) SCBT
- (98) DGIdb
- (99) ClinicalTrials
- (100) RVIS
- (101) SIGNOR
- (102) diseasecard
- (103) NIH Rare Diseases
- (104) Orphanet
- (105) UMLS
- (106) GTR
- (107) Disease Ontology
- (108) MedlinePlus Genetics
- (109) MeSH
- (110) MedlinePlus
- (111) CDC
- (112) NINDS
- (113) NCBI Bookshelf
- (114) ClinVar
- (115) Gene Damage Index
- (116) HPO
- (117) UDN
- (118) VISTA
- (119) FANTOM5
- (120) ENCODE
- (121) ProSci
- (122) Horizon
- (123) The Signaling Pathways Project (SPP)
- (124) IID
- (125) VectorBuilder
- (126) SNPedia
- (127) BRCA Exchange
- (128) CIViC
- (129) ProteoGenix
- (130) dbSUPER
- (131) TISSUES
- (132) Gene ORGANizer
- (133) abm
- (134) Human Protein Atlas
- (135) GWAS Catalog
- (136) Monarch Initiative
- (137) DataMed
- (138) HumanCyc
- (139) UCNEbase
- (140) EPDnew
- (141) Applied Biosystems
- (142) GlyConnect
- (143) Aminode
- (144) GeneCopoeia
- (145) GPS-Prot
- (146) RNAcentral
- (147) LncRNADisease
- (148) LOVD
- (149) miR2Disease
- (150) DiseaseEnhancer
- (151) Boster Bio
- (152) Biorbyt
- (153) Biocompare
- (154) Mastermind
- (155) CTD^2 Dashboard
- (156) CraniofacialAtlas
- (157) GeneImprint
- (158) Synthego
- (159) ENA
- (160) GtRNAdb
- (161) LncBase
- (162) LncBook
- (163) LNCipedia
- (164) Modomics
- (165) PDBe
- (166) Rfam
- (167) SILVA
- (168) snOPY
- (169) SRPDB
- (170) GENCODE
- (171) TarBase
- (172) Open Targets Platform
- (173) 5SRRNADB
- (174) snoDB
- (175) MirGeneDB
- (176) Alliance of Genome Resources