Aliases for DICER1 Gene
Aliases for DICER1 Gene
External Ids for DICER1 Gene
- HGNC: 17098
- Entrez Gene: 23405
- Ensembl: ENSG00000100697
- OMIM: 606241
- UniProtKB: Q9UPY3
Previous HGNC Symbols for DICER1 Gene
- MNG1
Previous GeneCards Identifiers for DICER1 Gene
- GC14M093065
- GC14M089372
- GC14M093542
- GC14M094622
- GC14M095552
- GC14M075736
Summaries for DICER1 Gene
-
This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2010]
GeneCards Summary for DICER1 Gene
DICER1 (Dicer 1, Ribonuclease III) is a Protein Coding gene. Diseases associated with DICER1 include Pleuropulmonary Blastoma and Goiter, Multinodular 1, With Or Without Sertoli-Leydig Cell Tumors. Among its related pathways are mRNA Splicing - Major Pathway and Hypoxia-mediated EMT and Stemness. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and hydrolase activity. An important paralog of this gene is FANCM.
UniProtKB/Swiss-Prot for DICER1 Gene
-
Double-stranded RNA (dsRNA) endoribonuclease playing a central role in short dsRNA-mediated post-transcriptional gene silencing. Cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3 overhang of two nucleotides, producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation. Gene silencing mediated by siRNAs, also called RNA interference, controls the elimination of transcripts from mobile and repetitive DNA elements of the genome but also the degradation of exogenous RNA of viral origin for instance. The miRNA pathway on the other side is a mean to specifically regulate the expression of target genes.
Additional gene information for DICER1 Gene
- Monarch Initiative
- Search for DICER1 at DataMed
- Search for DICER1 at HumanCyc
No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DICER1 Gene
Genomics for DICER1 Gene
GeneHancer (GH) Regulatory Elements for DICER1 Gene
Promoters and enhancers for DICER1 Gene
| GeneHancer (GH) Identifier | GH Type | GH Score |
GH Sources | Gene Association Score | Total Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites |
Gene Targets |
|---|---|---|---|---|---|---|---|---|---|---|
| GH14I095155 | Promoter/Enhancer | 2.3 | EPDnew Ensembl ENCODE dbSUPER | 555.5 | +0.9 | 903 | 3.2 | HDGF PKNOX1 ARID4B SIN3A FEZF1 DMAP1 ZNF2 ZBTB7B YY1 ZNF213 | DICER1 DICER1-AS1 MIR3173 | |
| GH14I095133 | Promoter | 0.6 | EPDnew | 550.3 | +24.6 | 24568 | 0.1 | EZH2 | DICER1 MIR3173 GC14M095074 | |
| GH14I095138 | Promoter | 0.5 | EPDnew | 550.3 | +21.2 | 21189 | 0.1 | MIR3173 DICER1 GC14M095074 | ||
| GH14I095260 | Enhancer | 1.7 | FANTOM5 Ensembl ENCODE dbSUPER | 26.3 | -106.2 | -106159 | 7.5 | PKNOX1 FOXA2 SMAD1 ARID4B SIN3A IRF4 YY1 ZNF143 FOS DEK | SNHG10 SCARNA13 CLMN DICER1 ENSG00000258615 | |
| GH14I094597 | Enhancer | 1.7 | FANTOM5 Ensembl ENCODE dbSUPER | 19.6 | +557.8 | 557806 | 6.1 | FOXA2 MLX ZFP64 ARID4B SIN3A DMAP1 YY1 SLC30A9 FOS SP5 | SERPINA10 SERPINA3 SERPINA1 SERPINA5 SCARNA13 SNHG10 DICER1 SERPINA6 SERPINA11 SERPINA4 |
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around DICER1 on UCSC Golden Path with GeneCards custom track
- Top Transcription factor binding sites by QIAGEN in the DICER1 gene promoter:
Regulatory Element Products
Genomic Locations for DICER1 Gene
Genomic Locations for DICER1 Gene
- chr14:95,086,228-95,158,010
- (GRCh38/hg38)
- Size:
- 71,783 bases
- Orientation:
- Minus strand
- chr14:95,552,565-95,624,347
- (GRCh37/hg19)
Genomic View for DICER1 Gene
Genes around DICER1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 14q32.13 by Ensembl
- 14q32.13 by Entrez Gene
- 14q32.13 by HGNC
DICER1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for DICER1 Gene
Proteins for DICER1 Gene
-
Protein details for DICER1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9UPY3-DICER_HUMAN
- Recommended name:
- Endoribonuclease Dicer
- Protein Accession:
- Q9UPY3
- A7E2D3
- B3KRG4
- E0AD28
- O95943
- Q9UQ02
Protein attributes for DICER1 Gene
- Size:
- 1922 amino acids
- Molecular mass:
- 218682 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Quaternary structure:
-
- Component of the RISC loading complex (RLC), or micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2; DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. Note that the trimeric RLC/miRLC is also referred to as RISC. Interacts with DHX9, AGO1, PIWIL1 and PRKRA. Associates with the 60S ribosome. Interacts with BCDIN3D. Interacts with AGO2, TARBP2, EIF6, MOV10 and RPL7A (60S ribosome subunit); they form a large RNA-induced silencing complex (RISC) (PubMed:17507929).
- SequenceCaution:
-
- Sequence=CAB38857.2; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Three dimensional structures from OCA and Proteopedia for DICER1 Gene
Protein Expression for DICER1 Gene
Selected DME Specific Peptides for DICER1 Gene
- Q9UPY3:
-
- QQVSAVRTH
- NRYCARLPSDPFTHLAPKC
- EDIEKSEAR
- IPHFPVYTRSGEVTISIEL
- PASLWRKAVCLPSILYRLHCLLTAEELRAQTA
- RSYVQSKGRAR
- DLTAINGLSYN
- DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNR
- LTDLRSA
- EEDIEVPKAMGDIFES
- EEDDFVVGFWNPSEENCG
- VSNCNLYRLGKK
- GKVRVTVEVV
- LKIPPRCMF
- LELITRLHQYIFSHILRLEKPALEFKP
- ECTLLSN
- PKAIPECLR
- LVVRFDLP
- VLGPWCADK
- LEEKIQKLE
- DFRYPNLDFGWK
- CPRILGLTASILNGKCDP
- PLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKV
- QPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFG
- GSGKTFIAVLL
- NRDFCQGN
- INLLVFDECHLAI
- LRKIHALCEE
- YRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKT
- PKCNLVVR
- RLEFLGDA
- TPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAA
- EDLKTYKAIEKILRNKCSKS
- DKSIADCVEAL
- RKFLLFTDT
- FKLEDYQDAVIIPR
- HPYREIMK
- HSKERDSTLISKQILSDC
- VWQVYYPMM
- INYRFKN
- FDYSSWDAMCYLDPSKA
- HLYEDPRQHSPG
- PSRMVVSIFDPPVNWLPPGY
- GYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFL
- STLYLPINSPLRA
- FEKKINY
- KQILVPELC
- DLKVGEYS
- TLDIDFKF
- QRLEFLGD
- DQMSVNC
- QPLLDVDHTS
Post-translational modifications for DICER1 Gene
Other Protein References for DICER1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Novus Biologicals Antibodies for DICER1
-
Abcam antibodies for DICER1
-
Cloud-Clone Corp. Antibodies for DICER1
- Invitrogen Antibodies for DICER1
- antibodies-online: Search results for 180 available DICER1 Antibodies ranked by validation data
- Compare Top DICER1 Antibodies
-
Recommended
- 101 WB Antibodies (anti-mouse)
- 12 IF (p) Antibodies (anti-mouse)
- 4 IHC (p) Antibodies (anti-mouse)
- 1 IF Antibody (anti-mouse)
- 1 IHC (fro) Antibody (anti-mouse)
- 1 IHC Antibody (anti-mouse)
- 1 IHC (p) Antibody (anti-rat)
- 12 IF (p) Antibodies (anti-rat)
- 48 WB Antibodies (anti-rat)
- 1 IHC (fro) Antibody (anti-human)
- 6 IHC Antibodies (anti-human)
- 12 IF (p) Antibodies (anti-human)
- 17 IHC (p) Antibodies (anti-human)
- 109 WB Antibodies (anti-human)
- GeneTex DICER1 antibody for DICER1
-
Santa Cruz Biotechnology (SCBT) Antibodies for DICER1
Protein Products
- Search Origene for MassSpec and Protein Over-expression Lysates for DICER1
- Origene Custom Protein Services for DICER1
-
Cloud-Clone Corp. Proteins for DICER1
- Search GeneTex for Proteins for DICER1
-
Abcam proteins for DICER1
Assay Products
-
Cloud-Clone Corp. Assay Kits for DICER1
Domains & Families for DICER1 Gene
Gene Families for DICER1 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Cancer-related genes
- Disease related genes
- Enzymes
- Plasma proteins
- Potential drug targets
- Predicted intracellular proteins
Protein Domains for DICER1 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for DICER1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q9UPY3- Family:
-
- Belongs to the helicase family. Dicer subfamily.
Function for DICER1 Gene
Molecular function for DICER1 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- Endonucleolytic cleavage to 5-phosphomonoester.
- UniProtKB/Swiss-Prot Function:
- Double-stranded RNA (dsRNA) endoribonuclease playing a central role in short dsRNA-mediated post-transcriptional gene silencing. Cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3 overhang of two nucleotides, producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation. Gene silencing mediated by siRNAs, also called RNA interference, controls the elimination of transcripts from mobile and repetitive DNA elements of the genome but also the degradation of exogenous RNA of viral origin for instance. The miRNA pathway on the other side is a mean to specifically regulate the expression of target genes.
Enzyme Numbers (IUBMB) for DICER1 Gene
Phenotypes From GWAS Catalog for DICER1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0003677 | DNA binding | IEA | -- |
| GO:0003723 | RNA binding | IEA | -- |
| GO:0003725 | double-stranded RNA binding | IMP | 19701182 |
| GO:0004386 | helicase activity | IEA | -- |
Phenotypes for DICER1 Gene
- MGI mutant phenotypes for DICER1:
-
inferred from 22 alleles
- nervous system phenotype
- normal phenotype
- homeostasis/metabolism phenotype
- respiratory system phenotype
- muscle phenotype
- cardiovascular system phenotype
- mortality/aging
- immune system phenotype
- cellular phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- neoplasm
- endocrine/exocrine gland phenotype
- reproductive system phenotype
- vision/eye phenotype
- integument phenotype
- embryo phenotype
- hematopoietic system phenotype
- skeleton phenotype
- renal/urinary system phenotype
- liver/biliary system phenotype
- craniofacial phenotype
- no phenotypic analysis
- limbs/digits/tail phenotype
- GenomeRNAi human phenotypes for DICER1:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Synthetic lethal with Ras
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased ionizing radiation sensitivity
- Decreased NF-kappaB reporter expression
- Increased shRNA abundance (Z-score > 2)
- Decreased shRNA abundance (Z-score < -2)
- Strongly decreased CFP-tsO45G cell surface transport
Animal Models for DICER1 Gene
Animal Model Products
-
Taconic Biosciences Mouse Models for DICER1
- Cyagen custom Knockout/knockin (KOKI) mouse models for DICER1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for DICER1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for DICER1 gene
- Search ViGene Biosciences for DICER1
CRISPR Products
-
OriGene CRISPR knockouts for DICER1
- genomics-online: gRNA clones - Search results for available DICER1 gene related products
- Applied Biological Materials CRISPR for DICER1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for DICER1
- GenScript: Design CRISPR guide RNA sequences for DICER1
miRNA for DICER1 Gene
- miRTarBase miRNAs that target DICER1
-
- hsa-let-7a-5p (MIRT004346)
- hsa-let-7d-5p (MIRT004347)
- hsa-let-7c-5p (MIRT004348)
- hsa-let-7b-5p (MIRT005322)
- hsa-mir-103a-3p (MIRT005347)
- hsa-mir-107 (MIRT005348)
- hsa-mir-519a-3p (MIRT005571)
- hsa-mir-374a-5p (MIRT005572)
- hsa-mir-154-5p (MIRT005679)
- hsa-mir-130a-3p (MIRT006258)
- hsa-mir-221-3p (MIRT006376)
- hsa-mir-222-3p (MIRT006377)
- hsa-mir-29a-3p (MIRT006379)
- hsa-mir-18a-5p (MIRT007178)
- hsa-mir-130b-3p (MIRT007384)
- hsa-mir-425-5p (MIRT016677)
- hsa-mir-29c-3p (MIRT020398)
- hsa-mir-215-5p (MIRT024517)
- hsa-mir-192-5p (MIRT026884)
- hsa-mir-98-5p (MIRT027858)
- hsa-mir-296-3p (MIRT038408)
- hsa-mir-16-5p (MIRT051245)
- hsa-mir-3928-3p (MIRT053189)
- hsa-mir-497-5p (MIRT053193)
- hsa-mir-195-5p (MIRT053194)
- hsa-mir-9-5p (MIRT054042)
- hsa-mir-581 (MIRT054786)
- hsa-mir-513a-3p (MIRT071643)
- hsa-mir-513c-3p (MIRT071645)
- hsa-mir-3606-3p (MIRT071646)
- hsa-mir-106a-3p (MIRT071648)
- hsa-mir-4282 (MIRT114873)
- hsa-mir-1263 (MIRT139578)
- hsa-mir-376a-5p (MIRT139613)
- hsa-mir-586 (MIRT280522)
- hsa-mir-382-5p (MIRT440814)
- hsa-mir-218-5p (MIRT440815)
- hsa-mir-377-5p (MIRT440816)
- hsa-mir-21-5p (MIRT440817)
- hsa-mir-6800-5p (MIRT478128)
- hsa-mir-498 (MIRT485634)
- hsa-mir-548aw (MIRT485635)
- hsa-mir-582-5p (MIRT485636)
- hsa-mir-1468-3p (MIRT485637)
- hsa-mir-548x-5p (MIRT485638)
- hsa-mir-548g-5p (MIRT485639)
- hsa-mir-548f-5p (MIRT485640)
- hsa-mir-548aj-5p (MIRT485641)
- hsa-mir-3613-3p (MIRT485642)
- hsa-mir-101-3p (MIRT485643)
- hsa-mir-148b-3p (MIRT485644)
- hsa-mir-148a-3p (MIRT485645)
- hsa-mir-152-3p (MIRT485646)
- hsa-mir-454-3p (MIRT485647)
- hsa-mir-301b-3p (MIRT485648)
- hsa-mir-3666 (MIRT485649)
- hsa-mir-301a-3p (MIRT485650)
- hsa-mir-4295 (MIRT485651)
- hsa-mir-19b-3p (MIRT485652)
- hsa-mir-19a-3p (MIRT485653)
- hsa-mir-5701 (MIRT558374)
- hsa-mir-8069 (MIRT558375)
- hsa-mir-1184 (MIRT558376)
- hsa-mir-3607-5p (MIRT558377)
- hsa-mir-4705 (MIRT558378)
- hsa-mir-7157-3p (MIRT630699)
- hsa-mir-6737-3p (MIRT630700)
- hsa-mir-5008-3p (MIRT630701)
- hsa-mir-6889-3p (MIRT630702)
- hsa-mir-519c-3p (MIRT630703)
- hsa-mir-519b-3p (MIRT630704)
- hsa-mir-15a-5p (MIRT727876)
- hsa-mir-15b-5p (MIRT727877)
- hsa-mir-31-3p (MIRT734964)
- hsa-mir-200a-3p (MIRT734965)
miRNA Products
- Search ViGene Biosciences for DICER1
- SwitchGear DICER1 3' UTR sequence
- SwitchGear DICER1 3' UTR sequence
- Browse SwitchGear 3'UTR luciferase reporter plasmids
Inhibitory RNA Products
- Origene shrna and RNAi products in human, mouse, rat for DICER1
- Browse OriGene Inhibitory RNA Products For DICER1
- genomics-online: shRNA clones - Search results for available DICER1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for DICER1 gene
Clone Products
- Sino Biological Human cDNA Clone for DICER1
- VectorBuilder custom plasmid, inducible vectors for DICER1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DICER1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for DICER1
- genomics-online: cdna clones - Search results for available DICER1 gene related products
- orf clones - Search results for available DICER1 gene related products
- Applied Biological Materials Clones for DICER1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
ViGene Biosciences adenoviral particle packaged cDNA for DICER1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for DICER1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for DICER1 gene
No data available for Transcription Factor Targets and HOMER Transcription for DICER1 Gene
Localization for DICER1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for DICER1 Gene
- Cytoplasm.
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| nucleus | 5 |
| cytosol | 5 |
| cytoskeleton | 1 |
| mitochondrion | 1 |
| peroxisome | 1 |
| endoplasmic reticulum | 1 |
- Cytosol (3)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IBA | -- |
| GO:0005737 | cytoplasm | IBA | -- |
| GO:0005793 | endoplasmic reticulum-Golgi intermediate compartment | IEA | -- |
| GO:0005829 | cytosol | TAS | -- |
| GO:0016442 | NOT RISC complex | IDA | 16357216 |
Pathways & Interactions for DICER1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Mitotic Prophase | ||
| 2 | mRNA Capping |
.01
|
|
| 3 | MicroRNAs in cancer | ||
| 4 | Translational Control | ||
| 5 | RNAi Pathway | ||
Pathways by source for DICER1 Gene
4 BioSystems pathways for DICER1 Gene
4 Reactome pathways for DICER1 Gene
1 KEGG pathway for DICER1 Gene
1 Qiagen pathway for DICER1 Gene
1 Cell Signaling Technology pathway for DICER1 Gene
Interacting Proteins for DICER1 Gene
Selected Interacting proteins:
ENSP00000343745
Q9UPY3-DICER_HUMAN
for DICER1 Gene via
STRING
MINT
IID
UniProtKB
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000122 | negative regulation of transcription by RNA polymerase II | ISS | -- |
| GO:0006309 | apoptotic DNA fragmentation | IBA | -- |
| GO:0006396 | RNA processing | IEA | -- |
| GO:0010586 | miRNA metabolic process | TAS | -- |
| GO:0010626 | negative regulation of Schwann cell proliferation | ISS | -- |
Transcripts for DICER1 Gene
mRNA/cDNA for DICER1 Gene
- (15) REFSEQ mRNAs :
- (19) Additional mRNA sequences :
- (320) Selected AceView cDNA sequences:
- (15) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for DICER1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for DICER1
- genomics-online: gRNA clones - Search results for available DICER1 gene related products
- Applied Biological Materials CRISPR for DICER1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for DICER1
- GenScript: Design CRISPR guide RNA sequences for DICER1
miRNA Products
- Search ViGene Biosciences for DICER1
- SwitchGear DICER1 3' UTR sequence
- SwitchGear DICER1 3' UTR sequence
- Browse SwitchGear 3'UTR luciferase reporter plasmids
Inhibitory RNA Products
- Origene shrna and RNAi products in human, mouse, rat for DICER1
- Browse OriGene Inhibitory RNA Products For DICER1
- genomics-online: shRNA clones - Search results for available DICER1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for DICER1 gene
Clone Products
- Sino Biological Human cDNA Clone for DICER1
- VectorBuilder custom plasmid, inducible vectors for DICER1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DICER1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for DICER1
- genomics-online: cdna clones - Search results for available DICER1 gene related products
- orf clones - Search results for available DICER1 gene related products
- Applied Biological Materials Clones for DICER1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
| ExUns: | 1a | · | 1b | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5 | ^ | 6 | ^ | 7 | ^ | 8a | · | 8b | ^ | 9 | ^ | 10a | · | 10b | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | ^ | 14 | ^ | 15a | · | 15b | ^ | 16 | ^ | 17a | · | 17b | ^ | 18 | ^ | 19a | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP9: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP10: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP11: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP12: |
| ExUns: | 19b | ^ | 20 | ^ | 21 | ^ | 22 | ^ | 23a | · | 23b | ^ | 24 | ^ | 25 | ^ | 26a | · | 26b | · | 26c | ^ | 27 | ^ | 28a | · | 28b | ^ | 29 | ^ | 30a | · | 30b | ^ | 31a | · | 31b | ^ | 32 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | |||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | |||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | |||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | |||||||||||||||||||||||||||||||||||
| SP5: | |||||||||||||||||||||||||||||||||||||||
| SP6: | |||||||||||||||||||||||||||||||||||||||
| SP7: | |||||||||||||||||||||||||||||||||||||||
| SP8: | |||||||||||||||||||||||||||||||||||||||
| SP9: | |||||||||||||||||||||||||||||||||||||||
| SP10: | |||||||||||||||||||||||||||||||||||||||
| SP11: | |||||||||||||||||||||||||||||||||||||||
| SP12: |
Expression for DICER1 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
This gene is overexpressed in Placenta (10.0), Pancreatic juice (9.5), Fetal Brain (6.8), and Lung (6.4).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DICER1 Gene
NURSA nuclear receptor signaling pathways regulating expression of DICER1 Gene:
DICER1SOURCE GeneReport for Unigene cluster for DICER1 Gene:
Hs.87889Evidence on tissue expression from TISSUES for DICER1 Gene
- Nervous system(4.9)
- Liver(4.6)
- Lung(4.5)
- Eye(2.5)
- Kidney(2.5)
- Muscle(2.5)
- Blood(2.3)
- Heart(2.3)
- Intestine(2.3)
- Thyroid gland(2.3)
Phenotype-based relationships between genes and organs from Gene ORGANizer for DICER1 Gene
Germ Layers:
- ectoderm
- endoderm
- mesoderm
Systems:
- cardiovascular
- digestive
- endocrine
- integumentary
- nervous
- reproductive
- respiratory
- skeletal muscle
- skeleton
- urinary
Regions:
Head and neck:
- brain
- cerebellum
- ear
- eye
- head
- hypothalamus
- jaw
- mandible
- maxilla
- mouth
- neck
- pituitary gland
- skull
- thyroid
Thorax:
- chest wall
- clavicle
- heart
- lung
- rib
- rib cage
- scapula
- sternum
Abdomen:
- adrenal gland
- intestine
- kidney
- large intestine
- small intestine
Pelvis:
- pelvis
- uterus
Limb:
- ankle
- arm
- digit
- elbow
- femur
- fibula
- finger
- foot
- forearm
- hand
- hip
- humerus
- knee
- lower limb
- radius
- shin
- shoulder
- thigh
- tibia
- toe
- ulna
- upper limb
- wrist
General:
- blood
- coagulation system
- peripheral nerve
- peripheral nervous system
- red blood cell
- skin
- spinal column
- vertebrae
Primer Products
-
OriGene qPCR primer pairs for DICER1
- genomics-online: primer clones - Search results for available DICER1 gene related products
Gene Expression Assay Products
No data available for mRNA differential expression in normal tissues and mRNA Expression by UniProt/SwissProt for DICER1 Gene
Orthologs for DICER1 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | DICER1 33 34 |
|
||
| dog (Canis familiaris) |
Mammalia | DICER1 33 34 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | DICER1 34 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | DICER1 34 |
|
OneToOne | |
| cow (Bos Taurus) |
Mammalia | DICER1 33 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Dicer1 33 |
|
||
| mouse (Mus musculus) |
Mammalia | Dicer1 33 16 34 |
|
||
| chicken (Gallus gallus) |
Aves | DICER1 33 34 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | DICER1 34 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | dicer1 33 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | dicer1 33 34 |
|
||
| wufc39d11 33 |
|
||||
| fruit fly (Drosophila melanogaster) |
Insecta | Dcr-1 35 33 34 |
|
||
| Dcr-2 35 |
|
|
|||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP002836 33 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | dcr-1 35 33 34 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToOne | |
| fission yeast (Schizosaccharomyces pombe) |
Schizosaccharomycetes | dcr1 33 |
|
||
| bread mold (Neurospora crassa) |
Ascomycetes | NCU08270 33 |
|
||
| sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.14057 33 |
|
- Species where no ortholog for DICER1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for DICER1 Gene
(1) SIMAP similar genes for DICER1 Gene using alignment to 4 proteins:
Pseudogenes.org Pseudogenes for DICER1 Gene
Variants for DICER1 Gene
| SNP ID | Clin | Chr 14 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1006363970 | uncertain-significance, DICER1-related pleuropulmonary blastoma cancer predisposition syndrome | 95,117,662(-) | C/A/T | 5_prime_UTR_variant, coding_sequence_variant, missense_variant | |
| rs1006671935 | uncertain-significance, DICER1-related pleuropulmonary blastoma cancer predisposition syndrome | 95,103,729(-) | A/G | coding_sequence_variant, missense_variant | |
| rs1007754435 | uncertain-significance, Hereditary cancer-predisposing syndrome | 95,116,599(-) | G/A | coding_sequence_variant, missense_variant | |
| rs1010614154 | likely-benign, DICER1-related pleuropulmonary blastoma cancer predisposition syndrome, Hereditary cancer-predisposing syndrome | 95,107,953(-) | C/A/G/T | coding_sequence_variant, synonymous_variant | |
| rs10144436 | benign, Pleuropulmonary blastoma | 95,090,065(-) | C/A | 3_prime_UTR_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv3635396 | CNV | gain | 21293372 |
| nsv1036738 | CNV | gain | 25217958 |
| nsv471967 | CNV | novel sequence insertion | 20440878 |
| nsv84515 | CNV | deletion | 16902084 |
Residual Variation Intolerance Score:
1.88% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
2.69;
46.11% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for DICER1 Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DICER1 Gene
Disorders for DICER1 Gene
(33) MalaCards diseases for DICER1 Gene - From: HGMD, OMIM, ClinVar, GTR, Orphanet, Swiss-Prot, DISEASES, and GeneCards
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| pleuropulmonary blastoma |
|
|
| goiter, multinodular 1, with or without sertoli-leydig cell tumors |
|
|
| rhabdomyosarcoma, embryonal, 2 |
|
|
| dicer1-related pleuropulmonary blastoma cancer predisposition syndrome |
|
|
| pineoblastoma |
|
|
Search DICER1 in MalaCards
View complete list of genes associated with diseases
UniProtKB/Swiss-Prot
DICER_HUMAN- Goiter multinodular 1, with or without Sertoli-Leydig cell tumors (MNG1) [MIM:138800]: A common disorder characterized by nodular overgrowth of the thyroid gland. Some individuals may also develop Sertoli-Leydig cell tumors, usually of the ovary. {ECO:0000269 PubMed:21205968}. Note=The disease is caused by mutations affecting the gene represented in this entry.
- Note=DICER1 mutations have been found in uterine cervix embryonal rhabdomyosarcoma, primitive neuroectodermal tumor, Wilms tumor, pulmonary sequestration and juvenile intestinal polyp (PubMed:21882293). Somatic missense mutations affecting the RNase IIIb domain of DICER1 are common in non-epithelial ovarian tumors. These mutations do not abolish DICER1 function but alter it in specific cell types, a novel mechanism through which perturbation of microRNA processing may be oncogenic (PubMed:22187960). {ECO:0000269 PubMed:21882293, ECO:0000269 PubMed:22187960}.
- Pleuropulmonary blastoma (PPB) [MIM:601200]: A rare pediatric intrathoracic neoplasm. The tumor arises from the lung, pleura, or both, and appears to be purely mesenchymal in phenotype. It lacks malignant epithelial elements, a feature that distinguishes it from the classic adult-type pulmonary blastoma. It arises during fetal lung development and is often part of an inherited cancer syndrome. The tumor contain both epithelial and mesenchymal cells. Early in tumorigenesis, cysts form in lung airspaces, and these cysts are lined with benign-appearing epithelium. Mesenchymal cells susceptible to malignant transformation reside within the cyst walls and form a dense layer beneath the epithelial lining. In a subset of patients, overgrowth of the mesenchymal cells produces a sarcoma, a transition that is associated with a poorer prognosis. Some patients have multilocular cystic nephroma, a benign kidney tumor. {ECO:0000269 PubMed:19556464}. Note=The disease is caused by mutations affecting the gene represented in this entry.
- Rhabdomyosarcoma, embryonal, 2 (RMSE2) [MIM:180295]: A form of rhabdomyosarcoma, a highly malignant tumor of striated muscle derived from primitive mesenchymal cells and exhibiting differentiation along rhabdomyoblastic lines. Rhabdomyosarcoma is one of the most frequently occurring soft tissue sarcomas and the most common in children. It occurs in four forms: alveolar, pleomorphic, embryonal and botryoidal rhabdomyosarcomas. {ECO:0000269 PubMed:21882293}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Additional Disease Information for DICER1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for Genatlas for DICER1 Gene
Publications for DICER1 Gene
- DICER1 mutations in familial multinodular goiter with and without ovarian Sertoli-Leydig cell tumors. (PMID: 21205968) Rio Frio T … Tischkowitz M (JAMA 2011) 2 3 4 58
- DICER1 mutations in familial pleuropulmonary blastoma. (PMID: 19556464) Hill DA … Goodfellow PJ (Science (New York, N.Y.) 2009) 3 4 22 58
- The role of PACT in the RNA silencing pathway. (PMID: 16424907) Lee Y … Kim VN (The EMBO journal 2006) 3 4 22 58
- A human, ATP-independent, RISC assembly machine fueled by pre-miRNA. (PMID: 16357216) Maniataki E … Mourelatos Z (Genes & development 2005) 3 4 22 58
- Characterization of the interactions between mammalian PAZ PIWI domain proteins and Dicer. (PMID: 14749716) Tahbaz N … Hobman TC (EMBO reports 2004) 3 4 22 58
Products for DICER1 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for DICER1
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for DICER1
- Origene Custom Protein Services for DICER1
- Origene shrna and RNAi products in human, mouse, rat for DICER1
- Browse OriGene Inhibitory RNA Products For DICER1
- OriGene qPCR primer pairs for DICER1
- OriGene CRISPR knockouts for DICER1
- OriGene ORF clones in human for DICER1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For DICER1
- GenScript: Next-day shipping of latest version cDNA ORF clones for DICER1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for DICER1
- GenScript Custom Assay Services for DICER1
- GenScript Custom overexpressing Cell Line Services for DICER1
- GenScript: Design CRISPR guide RNA sequences for DICER1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for DICER1
- Sino Biological Human cDNA Clone for DICER1
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for DICER1
- Novus Biologicals lysates and proteins for DICER1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for DICER1
- Abcam proteins for DICER1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Cloud-Clone Corp. Antibodies for DICER1
- Cloud-Clone Corp. Proteins for DICER1
- Cloud-Clone Corp. Assay Kits for DICER1
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Taconic Biosciences Mouse Models for DICER1
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for DICER1
- Cyagen custom Knockout/knockin (KOKI) mouse models for DICER1
- VectorBuilder custom plasmid, inducible vectors for DICER1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DICER1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for DICER1
- antibodies-online: Search results for 180 available DICER1 Antibodies ranked by validation data
- Compare Top DICER1 Antibodies
- Recommended
- 101 WB Antibodies (anti-mouse)
- 12 IF (p) Antibodies (anti-mouse)
- 4 IHC (p) Antibodies (anti-mouse)
- 1 IF Antibody (anti-mouse)
- 1 IHC (fro) Antibody (anti-mouse)
- 1 IHC Antibody (anti-mouse)
- 109 WB Antibodies (anti-human)
- 17 IHC (p) Antibodies (anti-human)
- 12 IF (p) Antibodies (anti-human)
- 6 IHC Antibodies (anti-human)
- 1 IHC (fro) Antibody (anti-human)
- 48 WB Antibodies (anti-rat)
- 12 IF (p) Antibodies (anti-rat)
- 1 IHC (p) Antibody (anti-rat)
- antibodies-online: Search results for 13 available DICER1 Elisa Kits ranked by validation data
- Compare Top DICER1 Elisa Kits
- antibodies-online: Search results for 4 available DICER1 Proteins ranked by validation data
- Compare Top DICER1 Proteins
- GeneTex DICER1 antibody for DICER1
- Search GeneTex for Proteins for DICER1
- ViGene Biosciences adenoviral particle packaged cDNA for DICER1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for DICER1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for DICER1 gene
- Search ViGene Biosciences for DICER1
- Santa Cruz Biotechnology (SCBT) Antibodies for DICER1
- Search Santa Cruz Biotechnology (SCBT) for DICER1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for DICER1
- genomics-online: cdna clones - Search results for available DICER1 gene related products
- orf clones - Search results for available DICER1 gene related products
- genomics-online: gRNA clones - Search results for available DICER1 gene related products
- genomics-online: primer clones - Search results for available DICER1 gene related products
- genomics-online: shRNA clones - Search results for available DICER1 gene related products
Sources for DICER1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew
- (158) Applied Biosystems
