DHX9 Gene (Protein Coding)

DExH-Box Helicase 9

GC01P182839
GIFtS:
41
This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of re... See more...

Aliases for DHX9 Gene

Aliases for DHX9 Gene

  • DExH-Box Helicase 9 2 3 4 5
  • Nuclear DNA Helicase II 2 3 4
  • RNA Helicase A 2 3 4
  • Leukophysin 2 3 4
  • DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9 2 3
  • DEAH (Asp-Glu-Ala-His) Box Helicase 9 2 3
  • ATP-Dependent RNA Helicase A 3 4
  • DEAH Box Protein 9 3 4
  • NDH II 2 4
  • DDX9 3 4
  • NDH2 3 4
  • LKP 3 4
  • RHA 2 3
  • DEAH (Asp-Glu-Ala-His) Box Polypeptide 9 3
  • DEAH-Box Helicase 9 3
  • EC 3.6.1.15 51
  • EC 3.6.4.13 4
  • EC 3.6.1 51
  • NDHII 3
  • DHX9 5

External Ids for DHX9 Gene

Previous HGNC Symbols for DHX9 Gene

  • LKP
  • DDX9

Previous GeneCards Identifiers for DHX9 Gene

  • GC01P179328
  • GC01P180047
  • GC01P180029
  • GC01P179540
  • GC01P181075
  • GC01P182808
  • GC01P154044

Summaries for DHX9 Gene

Entrez Gene Summary for DHX9 Gene

  • This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.[provided by RefSeq, Feb 2010]

GeneCards Summary for DHX9 Gene

DHX9 (DExH-Box Helicase 9) is a Protein Coding gene. Diseases associated with DHX9 include Werner Syndrome and Abnormal Retinal Correspondence. Among its related pathways are mRNA Splicing - Major Pathway and RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and helicase activity. An important paralog of this gene is DHX57.

UniProtKB/Swiss-Prot Summary for DHX9 Gene

  • Multifunctional ATP-dependent nucleic acid helicase that unwinds DNA and RNA in a 3' to 5' direction and that plays important roles in many processes, such as DNA replication, transcriptional activation, post-transcriptional RNA regulation, mRNA translation and RNA-mediated gene silencing (PubMed:9111062, PubMed:11416126, PubMed:12711669, PubMed:15355351, PubMed:16680162, PubMed:17531811, PubMed:20669935, PubMed:21561811, PubMed:24049074, PubMed:25062910, PubMed:24990949, PubMed:28221134). Requires a 3'-single-stranded tail as entry site for acid nuclei unwinding activities as well as the binding and hydrolyzing of any of the four ribo- or deoxyribo-nucleotide triphosphates (NTPs) (PubMed:1537828). Unwinds numerous nucleic acid substrates such as double-stranded (ds) DNA and RNA, DNA:RNA hybrids, DNA and RNA forks composed of either partially complementary DNA duplexes or DNA:RNA hybrids, respectively, and also DNA and RNA displacement loops (D- and R-loops), triplex-helical DNA (H-DNA) structure and DNA and RNA-based G-quadruplexes (PubMed:20669935, PubMed:21561811, PubMed:24049074). Binds dsDNA, single-stranded DNA (ssDNA), dsRNA, ssRNA and poly(A)-containing RNA (PubMed:9111062, PubMed:10198287). Binds also to circular dsDNA or dsRNA of either linear and/or circular forms and stimulates the relaxation of supercoiled DNAs catalyzed by topoisomerase TOP2A (PubMed:12711669). Plays a role in DNA replication at origins of replication and cell cycle progression (PubMed:24990949). Plays a role as a transcriptional coactivator acting as a bridging factor between polymerase II holoenzyme and transcription factors or cofactors, such as BRCA1, CREBBP, RELA and SMN1 (PubMed:11149922, PubMed:9323138, PubMed:9662397, PubMed:11038348, PubMed:11416126, PubMed:15355351, PubMed:28221134). Binds to the CDKN2A promoter (PubMed:11038348). Plays several roles in post-transcriptional regulation of gene expression (PubMed:28221134, PubMed:28355180). In cooperation with NUP98, promotes pre-mRNA alternative splicing activities of a subset of genes (PubMed:11402034, PubMed:16680162, PubMed:28221134, PubMed:28355180). As component of a large PER complex, is involved in the negative regulation of 3' transcriptional termination of circadian target genes such as PER1 and NR1D1 and the control of the circadian rhythms (By similarity). Acts also as a nuclear resolvase that is able to bind and neutralize harmful massive secondary double-stranded RNA structures formed by inverted-repeat Alu retrotransposon elements that are inserted and transcribed as parts of genes during the process of gene transposition (PubMed:28355180). Involved in the positive regulation of nuclear export of constitutive transport element (CTE)-containing unspliced mRNA (PubMed:9162007, PubMed:10924507, PubMed:11402034). Component of the coding region determinant (CRD)-mediated complex that promotes cytoplasmic MYC mRNA stability (PubMed:19029303). Plays a role in mRNA translation (PubMed:28355180). Positively regulates translation of selected mRNAs through its binding to post-transcriptional control element (PCE) in the 5'-untranslated region (UTR) (PubMed:16680162). Involved with LARP6 in the translation stimulation of type I collagen mRNAs for CO1A1 and CO1A2 through binding of a specific stem-loop structure in their 5'-UTRs (PubMed:22190748). Stimulates LIN28A-dependent mRNA translation probably by facilitating ribonucleoprotein remodeling during the process of translation (PubMed:21247876). Plays also a role as a small interfering (siRNA)-loading factor involved in the RNA-induced silencing complex (RISC) loading complex (RLC) assembly, and hence functions in the RISC-mediated gene silencing process (PubMed:17531811). Binds preferentially to short double-stranded RNA, such as those produced during rotavirus intestinal infection (PubMed:28636595). This interaction may mediate NLRP9 inflammasome activation and trigger inflammatory response, including IL18 release and pyroptosis (PubMed:28636595). Finally, mediates the attachment of heterogeneous nuclear ribonucleoproteins (hnRNPs) to actin filaments in the nucleus (PubMed:11687588).
  • (Microbial infection) Plays a role in HIV-1 replication and virion infectivity (PubMed:11096080, PubMed:19229320, PubMed:25149208, PubMed:27107641). Enhances HIV-1 transcription by facilitating the binding of RNA polymerase II holoenzyme to the proviral DNA (PubMed:11096080, PubMed:25149208). Binds (via DRBM domain 2) to the HIV-1 TAR RNA and stimulates HIV-1 transcription of transactivation response element (TAR)-containing mRNAs (PubMed:9892698, PubMed:11096080). Involved also in HIV-1 mRNA splicing and transport (PubMed:25149208). Positively regulates HIV-1 gag mRNA translation, through its binding to post-transcriptional control element (PCE) in the 5'-untranslated region (UTR) (PubMed:16680162). Binds (via DRBM domains) to a HIV-1 double-stranded RNA region of the primer binding site (PBS)-segment of the 5'-UTR, and hence stimulates DHX9 incorporation into virions and virion infectivity (PubMed:27107641). Plays also a role as a cytosolic viral MyD88-dependent DNA and RNA sensors in plasmacytoid dendritic cells (pDCs), and hence induce antiviral innate immune responses (PubMed:20696886, PubMed:21957149). Binds (via the OB-fold region) to viral single-stranded DNA unmethylated C-phosphate-G (CpG) oligonucleotide (PubMed:20696886).

Gene Wiki entry for DHX9 Gene

Additional gene information for DHX9 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for DHX9 Gene

Genomics for DHX9 Gene

GeneHancer (GH) Regulatory Elements Pubs

Download GeneHancer 2017 data
Promoters and enhancers for DHX9 Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH01J182838 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE CraniofacialAtlas 312.4 +1.1 1054 4.4 ZSCAN16 CHD2 TBP ZBTB10 MXD4 FEZF1 MNT DEK IKZF1 SMAD5 DHX9 ENSG00000287808 LOC647070 lnc-SHCBP1L-1 LAMC1 HMGN1P4 SMG7 NONHSAG003678.2 SHCBP1L
GH01J183469 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 199.1 +632.5 632507 4.3 ZSCAN16 CHD2 TBP ZBTB10 BCL11A SP1 FEZF1 CEBPA SIX5 NR2C1 SMG7 SMG7-AS1 HSALNG0008973 DHX9 LAMC1-AS1 HMGN1P4 LAMC1 ENSG00000271387 RNASEL LAMC2
GH01J182388 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 67 -448.3 -448346 5.6 CHD2 TBP SP1 ZBTB10 MXD4 FEZF1 MNT IKZF1 SMAD5 ZFP64 GLUL HSALNG0008911 HSALNG0008912 DHX9 LAMC1-AS1 HMGN1P4 RNASEL LAMC2 TEDDM1 HSALNG0008910
GH01J182881 Promoter 0.4 EPDnew 260.7 +42.0 41970 0.1 RBM22 DHX9 MN309024 MN309023 SHCBP1L
GH01J182235 Enhancer 1.2 Ensembl ENCODE 70.2 -603.0 -603047 3.4 FOXA1 MBD2 BHLHE40 NONO ZIC2 ARNT ZNF395 ZNF521 TRIM25 ZEB2 DHX9 LAMC1-AS1 HMGN1P4 EIF1P3 piR-57965-002 lnc-RGSL1-6 LINC01344 ZNF648 GLUL HSALNG0008888-001
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around DHX9 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for DHX9

Top Transcription factor binding sites by QIAGEN in the DHX9 gene promoter:
  • CREB
  • deltaCREB
  • E47
  • Pax-5
  • SREBP-1a
  • SREBP-1b
  • SREBP-1c
  • Tal-1

Genomic Locations for DHX9 Gene

Latest Assembly
chr1:182,839,347-182,887,982
(GRCh38/hg38)
Size:
48,636 bases
Orientation:
Plus strand

Previous Assembly
chr1:182,808,482-182,857,117
(GRCh37/hg19 by Entrez Gene)
Size:
48,636 bases
Orientation:
Plus strand

chr1:182,808,504-182,856,886
(GRCh37/hg19 by Ensembl)
Size:
48,383 bases
Orientation:
Plus strand

Genomic View for DHX9 Gene

Genes around DHX9 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DHX9 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DHX9 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for DHX9 Gene

Proteins for DHX9 Gene

Products:

  1. Antibodies for research
  2. Protein products for research
  3. Assay products for research

  • Protein details for DHX9 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q08211-DHX9_HUMAN
    Recommended name:
    ATP-dependent RNA helicase A
    Protein Accession:
    Q08211
    Secondary Accessions:
    • B2RNV4
    • Q05CI5
    • Q12803
    • Q32Q22
    • Q5VY62
    • Q6PD69
    • Q99556

    Protein attributes for DHX9 Gene

    Size:
    1270 amino acids
    Molecular mass:
    140958 Da
    Quaternary structure:
    • Component of the coding region determinant (CRD)-mediated complex, composed of DHX9, HNRNPU, IGF2BP1, SYNCRIP and YBX1 (PubMed:19029303). Identified in a mRNP complex, at least composed of DHX9, DDX3X, ELAVL1, HNRNPU, IGF2BP1, ILF3, PABPC1, PCBP2, PTBP2, STAU1, STAU2, SYNCRIP and YBX1 (PubMed:19029303). Identified in a IGF2BP1-dependent mRNP granule complex containing untranslated mRNAs (PubMed:17289661). The large PER complex involved in the repression of transcriptional termination is composed of at least PER2, CDK9, DDX5, DHX9, NCBP1 and POLR2A (active) (By similarity). Associates (via DRBM domains) with the RISC complex; this association occurs in a small interfering (siRNA)-dependent manner (PubMed:17531811, PubMed:23361462). Associates with the SMN complex; this association induces recruitment of DHX9 to the RNA polymerase II (ref.8). Associates with polysomes in a LIN28A-dependent manner (PubMed:16680162, PubMed:21247876). Interacts (via C-terminus) with ACTB; this interaction is direct and mediates the attachment to nuclear ribonucleoprotein complexes (PubMed:11687588). Interacts with ADAR isoform 1; this interaction occurs in a RNA-independent manner (PubMed:28355180). Interacts (via DRBM domains) with AGO2 (via middle region); this interaction promotes active RISC assembly by promoting the association of siRNA with AGO2 (PubMed:17531811, PubMed:23361462). Interacts (via RGG region) with AKAP8L (via N-terminus) (PubMed:11402034). Interacts with BRCA1 (via C-terminus); this interaction is direct and links BRCA1 to the RNA polymerase II holoenzyme (PubMed:9662397). Interacts (via N-terminus) with CREBBP; this interaction mediates association with RNA polymerase II holoenzyme and stimulates CREB-dependent transcriptional activation (PubMed:9323138). Interacts (via N-terminus) with EIF2AK2/PKR; this interaction is dependent upon the activation of the kinase (PubMed:19229320). Interacts (via DRBM domains) with DICER1 (PubMed:17531811). Interacts with H2AX; this interaction is direct, requires phosphorylation of histone H2AX on 'Ser-140' by PRKDC and promotes binding of DHX9 to transcriptionally stalled sites on chromosomal DNA in response to genotoxic stress (PubMed:15613478, PubMed:17498979). Interacts with HNRNPC; this interaction is direct, enhanced probably by their concomitant binding to RNA and mediates the attachment to actin filaments (PubMed:11687588). Interacts (via RGG region) with PRMT1 (PubMed:15084609). Interacts with IGF2BP1 (PubMed:17289661, PubMed:23640942). Interacts with IGF2BP2, IGF2BP3 (PubMed:23640942). Interacts (via DRBM domains) with ILF3; this interaction occurs in a RNA-independent manner (PubMed:12946349). Interacts with Importin alpha/Importin beta receptor (PubMed:16375861). Interacts with LARP6 (via C-terminus); this interaction occurs in a mRNA-independent manner (PubMed:22190748). Interacts (via N- and C-terminus) with LIN28A (via C-terminus); this interaction occurs in a RNA-independent manner (PubMed:21247876). Interacts with LMX1B (PubMed:23308148). Interacts (via helicase C-terminal domain, HA2 and OB-fold regions) with MAVS (via CARD domain); this interaction occurs in both resting and double-stranded RNA poly(I:C)-induced cells (PubMed:21957149). Interacts with MBD2; this interaction stimulates transcriptional activation in a CREB-dependent manner (PubMed:12665568). Interacts (via H2A and OB-fold regions) with MYD88 (via TIR domain); this interaction is direct (PubMed:20696886). Interacts with NLRP9 upon rotavirus infection; this interaction may trigger NLRP9 inflammasome activation and inflammatory response (PubMed:28636595). Interacts (via DRBM, OB-fold and RGG regions) with NUP98 (via N-terminus); this interaction occurs in a RNA-dependent manner and stimulates DHX9-mediated ATPase activity and regulates transcription and splicing of a subset of genes (PubMed:28221134). Interacts (via N-terminus) with NXF1 (via N-terminus); this interaction is direct and negatively regulates NXF1-mediated nuclear export of constitutive transport element (CTE)-containing cellular mRNAs (PubMed:10924507). Interacts with RELA; this interaction is direct and activates NF-kappa-B-mediated transcription (PubMed:15355351). Interacts (via MTAD region) with RNA polymerase II holoenzyme; this interaction stimulates transcription activation in a CREB-dependent manner (PubMed:11149922, PubMed:9323138, PubMed:11416126). Interacts (via RGG region) with SMN1; this interaction links SMN1 to the RNA polymerase II holoenzyme (PubMed:11149922). Interacts with SP7 (PubMed:17303075). Interacts (via DRBM domains) with TARBP2 (via DRBM first and second domains); this interaction occurs in a small interfering (siRNA)-dependent manner (PubMed:17531811, PubMed:23361462). Interacts with TOP2A; this interaction occurs in a E2 enzyme UBE2I- and RNA-dependent manner, negatively regulates DHX9-mediated double-stranded DNA and RNA duplex helicase activity and stimulates TOP2A-mediated supercoiled DNA relaxation activity (PubMed:12711669). Interacts (via DRBM domains and C-terminus) with WRN (via 3'-5' exonuclease domain); this interaction inhibits the DNA-dependent NTPase and DNA helicase activities of DHX9 and stimulates the 3'-5' exonuclease activity of WRN (PubMed:15995249). Interacts with XRCC5; this interaction occurs in a RNA-dependent manner (PubMed:14704337). Interacts with ZIC2 (via C2H2-type domain 3) (PubMed:17251188). Interacts with MCM3AP isoform GANP (PubMed:23652018).

    Three dimensional structures from OCA and Proteopedia for DHX9 Gene

    Alternative splice isoforms for DHX9 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DHX9 Gene

Protein Expression for DHX9 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for DHX9 Gene

Q08211:
  • SCALSLVRQL
  • GMGNSTNKKDAQ
  • FEPSQRQN
  • EKIRTRAISAKGMT
  • IVVTQPR
  • RDFVNYLVR
  • GDGPRPPKMAR
  • PLQLLLFASKKV
  • AYPEVRIVLMSATIDT
  • GGPLPPHL
  • MQKHLEMNPHFGSH
  • DVVYVID
  • PFFVFGEKIRTRA
  • GCIFYVGDA
  • AERVAFER
  • RGANLKDYY
  • LPVKKFE
  • ILSTNIAE
  • ATVWASKTN
  • AETSITI
  • FRTPLHE
  • KNFLYAWCGK
  • NDELTPLGRILAKLPIEPR
  • RFCEHKRLNMATLRMTWEAKVQLK
  • AATCFPEPFI
  • GVLLRKL
  • KYPSPFFVF
  • IVDEIHE
  • QVGPDHNRSFIAEMT
  • LPRPHAS
  • NTGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEGRN
  • ALSIKLLRLGGIG
  • TNIAETS
  • EQISMDLKNEL
  • GEEAEIRFCE
  • TQPRRISA
  • QLNEKETPFELIEALL
  • SQLDPVNE
  • QATLESEEVDLNAGLHGNWTLENAKARLNQ
  • YSGLTKKKEGE
  • VVIIRGATGCGKTTQVPQ
  • GIRGISHVIVDEIHERDINTDFLLVVLRDV
  • LEDCIQMT
  • AREHGSNKKLAAQSCALS
  • GVVPWSPPQ
  • EQRKVFDPVP

Post-translational modifications for DHX9 Gene

  • Methylated (PubMed:15084609). PRMT1-mediated methylation of undefined Arg residues in the RGG region is required for nuclear import of DHX9 (PubMed:15084609).
  • Phosphorylated by PRKDC; phosphorylation occurs in a RNA-dependent manner (PubMed:14704337). Phosphorylated by EIF2AK2/PKR; this phosphorylation reduces its association with double-stranded RNA (PubMed:19229320).
  • Ubiquitination at Lys1048, Lys146, Lys191, Lys417, Lys857, and Lys1037
  • Modification sites at PhosphoSitePlus

Other Protein References for DHX9 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for DHX9 Gene

Gene Families for DHX9 Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for DHX9 Gene

InterPro:
Blocks:
  • ATP-dependent helicase, DEAH-box
  • Helicase-associated region
  • Double-stranded RNA binding (DsRBD) domain
ProtoNet:

Suggested Antigen Peptide Sequences for DHX9 Gene

GenScript: Design optimal peptide antigens:
  • Nuclear DNA helicase II (DHX9_HUMAN)
  • DHX9 protein (Q05CI5_HUMAN)
  • Leukophysin (Q12803_HUMAN)
  • DHX9 protein (Q32Q22_HUMAN)
  • DHX9 protein (Q58F26_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q08211

UniProtKB/Swiss-Prot:

DHX9_HUMAN :
  • DRBM domains cooperate for the binding to nucleic acid but not for unwinding helicase activity (PubMed:9111062, PubMed:25062910). The helicase-associated domain-2 (HA2) region is essential for the duplex RNA unwinding helicase activity (PubMed:25062910). The minimal transactivation region (MTAD) mediates interaction with the RNA polymerase II holoenzyme and stimulates transcriptional activation in a CREB-dependent manner (PubMed:11416126). The oligonucleotide- or oligosaccharide-binding (OB-fold) and the repeated arginine and glycine-glycine (RGG) regions are dispensable for both RNA-binding and unwinding helicase activities (PubMed:25062910). The RGG region contains both nuclear localization signal (NLS) and nuclear export signal (NES) and is necessary and sufficient for nucleocytoplasmic shuttling in a RNA-independent manner (PubMed:10207077, PubMed:11149922).
  • Belongs to the DEAD box helicase family. DEAH subfamily.
Domain:
  • DRBM domains cooperate for the binding to nucleic acid but not for unwinding helicase activity (PubMed:9111062, PubMed:25062910). The helicase-associated domain-2 (HA2) region is essential for the duplex RNA unwinding helicase activity (PubMed:25062910). The minimal transactivation region (MTAD) mediates interaction with the RNA polymerase II holoenzyme and stimulates transcriptional activation in a CREB-dependent manner (PubMed:11416126). The oligonucleotide- or oligosaccharide-binding (OB-fold) and the repeated arginine and glycine-glycine (RGG) regions are dispensable for both RNA-binding and unwinding helicase activities (PubMed:25062910). The RGG region contains both nuclear localization signal (NLS) and nuclear export signal (NES) and is necessary and sufficient for nucleocytoplasmic shuttling in a RNA-independent manner (PubMed:10207077, PubMed:11149922).
Family:
  • Belongs to the DEAD box helicase family. DEAH subfamily.
genes like me logo Genes that share domains with DHX9: view

Function for DHX9 Gene

Products:

  1. Animal Models for research
  2. CRISPR products for research
  3. miRNA products for research
  4. Inhibitory RNAs for research
  5. Clone products for research
  6. Cell Lines for research

Molecular function for DHX9 Gene

UniProtKB/Swiss-Prot Function:
Multifunctional ATP-dependent nucleic acid helicase that unwinds DNA and RNA in a 3' to 5' direction and that plays important roles in many processes, such as DNA replication, transcriptional activation, post-transcriptional RNA regulation, mRNA translation and RNA-mediated gene silencing (PubMed:9111062, PubMed:11416126, PubMed:12711669, PubMed:15355351, PubMed:16680162, PubMed:17531811, PubMed:20669935, PubMed:21561811, PubMed:24049074, PubMed:25062910, PubMed:24990949, PubMed:28221134). Requires a 3'-single-stranded tail as entry site for acid nuclei unwinding activities as well as the binding and hydrolyzing of any of the four ribo- or deoxyribo-nucleotide triphosphates (NTPs) (PubMed:1537828). Unwinds numerous nucleic acid substrates such as double-stranded (ds) DNA and RNA, DNA:RNA hybrids, DNA and RNA forks composed of either partially complementary DNA duplexes or DNA:RNA hybrids, respectively, and also DNA and RNA displacement loops (D- and R-loops), triplex-helical DNA (H-DNA) structure and DNA and RNA-based G-quadruplexes (PubMed:20669935, PubMed:21561811, PubMed:24049074). Binds dsDNA, single-stranded DNA (ssDNA), dsRNA, ssRNA and poly(A)-containing RNA (PubMed:9111062, PubMed:10198287). Binds also to circular dsDNA or dsRNA of either linear and/or circular forms and stimulates the relaxation of supercoiled DNAs catalyzed by topoisomerase TOP2A (PubMed:12711669). Plays a role in DNA replication at origins of replication and cell cycle progression (PubMed:24990949). Plays a role as a transcriptional coactivator acting as a bridging factor between polymerase II holoenzyme and transcription factors or cofactors, such as BRCA1, CREBBP, RELA and SMN1 (PubMed:11149922, PubMed:9323138, PubMed:9662397, PubMed:11038348, PubMed:11416126, PubMed:15355351, PubMed:28221134). Binds to the CDKN2A promoter (PubMed:11038348). Plays several roles in post-transcriptional regulation of gene expression (PubMed:28221134, PubMed:28355180). In cooperation with NUP98, promotes pre-mRNA alternative splicing activities of a subset of genes (PubMed:11402034, PubMed:16680162, PubMed:28221134, PubMed:28355180). As component of a large PER complex, is involved in the negative regulation of 3' transcriptional termination of circadian target genes such as PER1 and NR1D1 and the control of the circadian rhythms (By similarity). Acts also as a nuclear resolvase that is able to bind and neutralize harmful massive secondary double-stranded RNA structures formed by inverted-repeat Alu retrotransposon elements that are inserted and transcribed as parts of genes during the process of gene transposition (PubMed:28355180). Involved in the positive regulation of nuclear export of constitutive transport element (CTE)-containing unspliced mRNA (PubMed:9162007, PubMed:10924507, PubMed:11402034). Component of the coding region determinant (CRD)-mediated complex that promotes cytoplasmic MYC mRNA stability (PubMed:19029303). Plays a role in mRNA translation (PubMed:28355180). Positively regulates translation of selected mRNAs through its binding to post-transcriptional control element (PCE) in the 5'-untranslated region (UTR) (PubMed:16680162). Involved with LARP6 in the translation stimulation of type I collagen mRNAs for CO1A1 and CO1A2 through binding of a specific stem-loop structure in their 5'-UTRs (PubMed:22190748). Stimulates LIN28A-dependent mRNA translation probably by facilitating ribonucleoprotein remodeling during the process of translation (PubMed:21247876). Plays also a role as a small interfering (siRNA)-loading factor involved in the RNA-induced silencing complex (RISC) loading complex (RLC) assembly, and hence functions in the RISC-mediated gene silencing process (PubMed:17531811). Binds preferentially to short double-stranded RNA, such as those produced during rotavirus intestinal infection (PubMed:28636595). This interaction may mediate NLRP9 inflammasome activation and trigger inflammatory response, including IL18 release and pyroptosis (PubMed:28636595). Finally, mediates the attachment of heterogeneous nuclear ribonucleoproteins (hnRNPs) to actin filaments in the nucleus (PubMed:11687588).
UniProtKB/Swiss-Prot Function:
(Microbial infection) Plays a role in HIV-1 replication and virion infectivity (PubMed:11096080, PubMed:19229320, PubMed:25149208, PubMed:27107641). Enhances HIV-1 transcription by facilitating the binding of RNA polymerase II holoenzyme to the proviral DNA (PubMed:11096080, PubMed:25149208). Binds (via DRBM domain 2) to the HIV-1 TAR RNA and stimulates HIV-1 transcription of transactivation response element (TAR)-containing mRNAs (PubMed:9892698, PubMed:11096080). Involved also in HIV-1 mRNA splicing and transport (PubMed:25149208). Positively regulates HIV-1 gag mRNA translation, through its binding to post-transcriptional control element (PCE) in the 5'-untranslated region (UTR) (PubMed:16680162). Binds (via DRBM domains) to a HIV-1 double-stranded RNA region of the primer binding site (PBS)-segment of the 5'-UTR, and hence stimulates DHX9 incorporation into virions and virion infectivity (PubMed:27107641). Plays also a role as a cytosolic viral MyD88-dependent DNA and RNA sensors in plasmacytoid dendritic cells (pDCs), and hence induce antiviral innate immune responses (PubMed:20696886, PubMed:21957149). Binds (via the OB-fold region) to viral single-stranded DNA unmethylated C-phosphate-G (CpG) oligonucleotide (PubMed:20696886).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; EC=3.6.4.13; Evidence={ECO:0000269|PubMed:11416126, ECO:0000269|PubMed:1537828, ECO:0000269|PubMed:20510246, ECO:0000269|PubMed:20669935, ECO:0000269|PubMed:24049074, ECO:0000269|PubMed:25062910, ECO:0000269|PubMed:8690889};.

Enzyme Numbers (IUBMB) for DHX9 Gene

Phenotypes From GWAS Catalog for DHX9 Gene

Gene Ontology (GO) - Molecular Function for DHX9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0000978 RNA polymerase II proximal promoter sequence-specific DNA binding IDA 11038348
GO:0000993 RNA polymerase II complex binding IDA 11416126
GO:0001069 regulatory region RNA binding IDA 28355180
GO:0001085 RNA polymerase II transcription factor binding IPI 17303075
genes like me logo Genes that share ontologies with DHX9: view
genes like me logo Genes that share phenotypes with DHX9: view

Animal Models for DHX9 Gene

MGI Knock Outs for DHX9:

Animal Models for research

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DHX9

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for DHX9 Gene

Localization for DHX9 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DHX9 Gene

Nucleus. Nucleus, nucleoplasm. Nucleus, nucleolus. Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Note=Nucleoplasmic shuttling protein (PubMed:10198287, PubMed:16375861, PubMed:10207077, PubMed:9162007). Its nuclear import involves the nucleocytoplasmic transport receptor Importin alpha/Importin beta receptor pathway in a Ran-dependent manner (PubMed:16375861). In interphase, localizes in nuclear stress granules and at perichromatin fibrils and in cytoplasmic ribonucleoprotein granules (PubMed:10198287). Colocalizes with WRN and H2AX at centrosomes in a microtubule-dependent manner following DNA damaging agent treatment (PubMed:17498979). Excluded from the mitotic nucleus as early as prophase and re-entered the nucleus at telophase (PubMed:10198287). Recruited in diffuse and discrete intranuclear foci (GLFG-body) in a NUP98-dependent manner (PubMed:28221134). Colocalizes with SP7 in the nucleus (PubMed:17303075). Colocalizes with ACTB at nuclear actin filaments inside the nucleus or at the nuclear pore (PubMed:11687588). Colocalizes with HNRNPC at nuclear ribonucleoprotein complex proteins in the nucleus (PubMed:11687588). Localized in cytoplasmic mRNP granules containing untranslated mRNAs (PubMed:17289661). {ECO:0000269 PubMed:10198287, ECO:0000269 PubMed:10207077, ECO:0000269 PubMed:11687588, ECO:0000269 PubMed:16375861, ECO:0000269 PubMed:17289661, ECO:0000269 PubMed:17303075, ECO:0000269 PubMed:17498979, ECO:0000269 PubMed:28221134, ECO:0000269 PubMed:9162007}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DHX9 gene
Compartment Confidence
cytoskeleton 5
nucleus 5
cytosol 4
plasma membrane 2
extracellular 2
mitochondrion 2
endosome 2
peroxisome 1
endoplasmic reticulum 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoli (3)
  • Nucleoplasm (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for DHX9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IBA 21873635
GO:0005634 nucleus TAS,IDA 9162007
GO:0005654 nucleoplasm TAS --
GO:0005726 perichromatin fibrils IDA 10198287
GO:0005730 nucleolus IBA,IDA --
genes like me logo Genes that share ontologies with DHX9: view

Pathways & Interactions for DHX9 Gene

genes like me logo Genes that share pathways with DHX9: view

SIGNOR curated interactions for DHX9 Gene

Activates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for DHX9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000380 alternative mRNA splicing, via spliceosome IMP 28221134
GO:0000398 mRNA splicing, via spliceosome TAS --
GO:0001649 osteoblast differentiation HDA 16210410
GO:0002376 immune system process IEA --
GO:0006260 DNA replication IEA --
genes like me logo Genes that share ontologies with DHX9: view

Drugs & Compounds for DHX9 Gene

Products:

  1. Drug products for research

(5) Drugs for DHX9 Gene - From: ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Water Approved Pharma 0
Phosphate Experimental Pharma 0
ATP Investigational Nutra 0
YK-4-279 Pharma RNA Helicase A (RHA) inhibitor 0

(2) Additional Compounds for DHX9 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
 58-64-0

(1) ApexBio Compounds for DHX9 Gene

Compound Action Cas Number
YK-4-279 RNA Helicase A (RHA) inhibitor 1037184-44-3
genes like me logo Genes that share compounds with DHX9: view

Drug products for research

Transcripts for DHX9 Gene

Products:

  1. CRISPR products for research
  2. miRNA products for research
  3. Inhibitory RNAs for research
  4. Clone products for research

mRNA/cDNA for DHX9 Gene

2 REFSEQ mRNAs :
23 NCBI additional mRNA sequence :
8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DHX9

Alternative Splicing Database (ASD) splice patterns (SP) for DHX9 Gene

No ASD Table

Relevant External Links for DHX9 Gene

GeneLoc Exon Structure for
DHX9

Expression for DHX9 Gene

Products:

  1. Primer products for research
  2. Gene Expression Assays for research

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for DHX9 Gene

mRNA expression in normal human tissues for DHX9 Gene
mRNA expression by BioGPS for DHX9 GenemRNA expression by GTEx for DHX9 Gene

Protein differential expression in normal tissues from HIPED for DHX9 Gene

This gene is overexpressed in Tlymphocyte (6.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for DHX9 Gene



Protein tissue co-expression partners for DHX9 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for DHX9

SOURCE GeneReport for Unigene cluster for DHX9 Gene:

Hs.191518

Evidence on tissue expression from TISSUES for DHX9 Gene

  • Nervous system(5)
  • Liver(4.7)
  • Blood(4.5)
  • Muscle(4.4)
  • Skin(3.7)
  • Heart(3.6)
  • Lung(3.6)
  • Kidney(3.4)
  • Eye(3.3)
  • Pancreas(3.1)
  • Intestine(3.1)
  • Adrenal gland(3)
  • Lymph node(2.7)
  • Bone marrow(2.7)
  • Spleen(2.6)
  • Gall bladder(2.6)
  • Thyroid gland(2.5)
  • Stomach(2.5)
genes like me logo Genes that share expression patterns with DHX9: view

Primer products for research

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for DHX9 Gene

Orthologs for DHX9 Gene

This gene was present in the common ancestor of animals.

Orthologs for DHX9 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
 Mammalia DHX9 30 31
  • 99.71 (n)
 OneToOne
Cow
(Bos Taurus)
 Mammalia DHX9 30 31
  • 92.13 (n)
 OneToOne
Dog
(Canis familiaris)
 Mammalia DHX9 30 31
  • 91.99 (n)
 OneToOne
Oppossum
(Monodelphis domestica)
 Mammalia DHX9 31
  • 90 (a)
 OneToOne
Mouse
(Mus musculus)
 Mammalia Dhx9 30 17 31
  • 89.34 (n)
 OneToOne
Rat
(Rattus norvegicus)
 Mammalia Dhx9 30
  • 89.16 (n)
Platypus
(Ornithorhynchus anatinus)
 Mammalia DHX9 31
  • 88 (a)
 OneToOne
Lizard
(Anolis carolinensis)
 Reptilia DHX9 31
  • 83 (a)
 OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
 Amphibia dhx9 30
  • 74.12 (n)
Str.7575 30
African clawed frog
(Xenopus laevis)
 Amphibia Xl.24763 30
Zebrafish
(Danio rerio)
 Actinopterygii dhx9 30 31
  • 70.28 (n)
 OneToOne
Dr.28193 30
Fruit Fly
(Drosophila melanogaster)
 Insecta mle 30 31
  • 54.71 (n)
 OneToOne
African malaria mosquito
(Anopheles gambiae)
 Insecta AgaP_AGAP006599 30
  • 53.36 (n)
Worm
(Caenorhabditis elegans)
 Secernentea rha-1 30 31
  • 52.53 (n)
 OneToOne
Sea Squirt
(Ciona savignyi)
 Ascidiacea -- 31
  • 60 (a)
 OneToOne
Sea Vase
(Ciona intestinalis)
 Ascidiacea Cin.178 30
Species where no ortholog for DHX9 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for DHX9 Gene

ENSEMBL:
Gene Tree for DHX9 (if available)
TreeFam:
Gene Tree for DHX9 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for DHX9: view image

Paralogs for DHX9 Gene

Paralogs for DHX9 Gene

(2) SIMAP similar genes for DHX9 Gene using alignment to 3 proteins:

  • DHX9_HUMAN
  • Q58F26_HUMAN
  • Q6PJK6_HUMAN

Pseudogenes.org Pseudogenes for DHX9 Gene

genes like me logo Genes that share paralogs with DHX9: view

Variants for DHX9 Gene

Products:

  1. SNP Genotyping and Copy Number Assays for research

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for DHX9 Gene

SNP ID Clinical significance and condition Chr 01 pos Variation AA Info Type
rs116290610 Benign: not provided 182,881,264(+) C/T
NM_001357.5(DHX9):c.2625C>T (p.Tyr875=) 		NON_CODING_TRANSCRIPT_VARIANT,SYNONYMOUS
rs201506072 Benign: not provided 182,881,348(+) C/T
NM_001357.5(DHX9):c.2709C>T (p.Ile903=) 		NON_CODING_TRANSCRIPT_VARIANT,SYNONYMOUS
rs73063090 Benign: not provided 182,852,350(+) G/T
NM_001357.5(DHX9):c.364+6G>T 		INTRON
rs73063095 Benign: not provided 182,858,162(+) G/A
NM_001357.5(DHX9):c.732G>A (p.Leu244=) 		NON_CODING_TRANSCRIPT_VARIANT,SYNONYMOUS
rs1049264 - p.Ile894Val

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for DHX9 Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for DHX9 Gene

Variant ID Type Subtype PubMed ID
esv2537876 CNV insertion 19546169
nsv548358 CNV gain 21841781
nsv998656 CNV gain 25217958

Variation tolerance for DHX9 Gene

Residual Variation Intolerance Score: 1.45% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.96; 19.81% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for DHX9 Gene

Human Gene Mutation Database (HGMD)
DHX9
SNPedia medical, phenotypic, and genealogical associations of SNPs for
DHX9

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DHX9 Gene

Disorders for DHX9 Gene

MalaCards: The human disease database

(6) MalaCards diseases for DHX9 Gene - From: COP and GCD

- elite association - COSMIC cancer census association via MalaCards
Search DHX9 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for DHX9

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform
genes like me logo Genes that share disorders with DHX9: view

No data available for UniProtKB/Swiss-Prot and Genatlas for DHX9 Gene

Publications for DHX9 Gene

  1. Domain structure of human nuclear DNA helicase II (RNA helicase A). (PMID: 9111062) Zhang S … Grosse F (The Journal of biological chemistry 1997) 2 3 4 23
  2. Werner syndrome helicase (WRN), nuclear DNA helicase II (NDH II) and histone gammaH2AX are localized to the centrosome. (PMID: 17498979) Zhang S … Grosse F (Cell biology international 2007) 3 4 23
  3. RNA helicase A is necessary for translation of selected messenger RNAs. (PMID: 16680162) Hartman TR … Boris-Lawrie K (Nature structural & molecular biology 2006) 3 4 23
  4. The nuclear import of RNA helicase A is mediated by importin-alpha3. (PMID: 16375861) Aratani S … Nakajima T (Biochemical and biophysical research communications 2006) 3 4 23
  5. Actinomycin D induces histone gamma-H2AX foci and complex formation of gamma-H2AX with Ku70 and nuclear DNA helicase II. (PMID: 15613478) Mischo HE … Zhang S (The Journal of biological chemistry 2005) 3 4 23

ExternalLinks

View latest publications for DHX9 gene in Mastermind

Products for DHX9 Gene

Sources for DHX9 Gene