DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD... See more...

Aliases for DHX30 Gene

Aliases for DHX30 Gene

  • DExH-Box Helicase 30 2 3 5
  • DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 30 2 3
  • ATP-Dependent RNA Helicase DHX30 3 4
  • DEAH-Box Helicase 30 2 3
  • DEAH Box Protein 30 3 4
  • DDX30 3 4
  • DEAH (Asp-Glu-Ala-His) Box Polypeptide 30 3
  • Putative ATP-Dependent RNA Helicase DHX30 3
  • DEAH (Asp-Glu-Ala-His) Box Helicase 30 3
  • Retina Co-Repressor 3
  • EC 3.6.4.13 4
  • KIAA0890 4
  • EC 3.6.1 54
  • NEDMIAL 3
  • RETCOR 3

External Ids for DHX30 Gene

Previous HGNC Symbols for DHX30 Gene

  • DDX30

Previous GeneCards Identifiers for DHX30 Gene

  • GC03P047663
  • GC03P047805
  • GC03P047819
  • GC03P047844

Summaries for DHX30 Gene

Entrez Gene Summary for DHX30 Gene

  • DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The family member encoded by this gene is a mitochondrial nucleoid protein that associates with mitochondrial DNA. It has also been identified as a component of a transcriptional repressor complex that functions in retinal development, and it is required to optimize the function of the zinc-finger antiviral protein. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2013]

GeneCards Summary for DHX30 Gene

DHX30 (DExH-Box Helicase 30) is a Protein Coding gene. Diseases associated with DHX30 include Neurodevelopmental Disorder With Severe Motor Impairment And Absent Language and Oculomotor Apraxia. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and chromatin binding. An important paralog of this gene is DHX57.

UniProtKB/Swiss-Prot Summary for DHX30 Gene

  • RNA-dependent helicase (PubMed:29100085). Plays an important role in the assembly of the mitochondrial large ribosomal subunit (PubMed:25683715, PubMed:29100085). Required for optimal function of the zinc-finger antiviral protein ZC3HAV1 (By similarity). Associates with mitochondrial DNA (PubMed:18063578). Involved in nervous system development and differentiation through its involvement in the up-regulation of a number of genes which are required for neurogenesis, including GSC, NCAM1, neurogenin, and NEUROD (By similarity).

Additional gene information for DHX30 Gene

No data available for CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for DHX30 Gene

Genomics for DHX30 Gene

GeneHancer (GH) Regulatory Elements for DHX30 Gene

Promoters and enhancers for DHX30 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around DHX30 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the DHX30 gene promoter:
  • c-Rel
  • Egr-1
  • Egr-2
  • En-1
  • NF-kappaB
  • NF-kappaB1
  • NF-kappaB2
  • p53
  • SEF-1 (1)
  • TBP

Genomic Locations for DHX30 Gene

Genomic Locations for DHX30 Gene
chr3:47,802,909-47,850,196
(GRCh38/hg38)
Size:
47,288 bases
Orientation:
Plus strand
chr3:47,844,399-47,891,686
(GRCh37/hg19)
Size:
47,288 bases
Orientation:
Plus strand

Genomic View for DHX30 Gene

Genes around DHX30 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DHX30 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DHX30 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DHX30 Gene

Proteins for DHX30 Gene

  • Protein details for DHX30 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q7L2E3-DHX30_HUMAN
    Recommended name:
    ATP-dependent RNA helicase DHX30
    Protein Accession:
    Q7L2E3
    Secondary Accessions:
    • A8K5F1
    • O94965
    • Q7Z753
    • Q96CH4
    • Q9NUQ0

    Protein attributes for DHX30 Gene

    Size:
    1194 amino acids
    Molecular mass:
    133938 Da
    Quaternary structure:
    • Identified in a complex with TFAM and SSBP1. Interacts with AGO1 and AGO2. Interacts (via N-terminus) with ZC3HAV1 (via N-terminal domain) in an RNA-independent manner (By similarity). Found in a complex with GRSF1, DDX28, FASTKD2 and FASTKD5 (PubMed:25683715).
    SequenceCaution:
    • Sequence=BAA74913.2; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=BAA92071.1; Type=Miscellaneous discrepancy; Note=Probable cloning artifact.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for DHX30 Gene

    Alternative splice isoforms for DHX30 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DHX30 Gene

Selected DME Specific Peptides for DHX30 Gene

Q7L2E3:
  • EGRGARCNV
  • KVPGFMYPVKE
  • EHGQLLALLAELLRGPCGSFD
  • IKAVDEAVILLQEIGVLDQRE
  • HKEERYDLKTKVSCLETVWVS
  • ISTDPRLAKAIVLA
  • LRLVLMSATGDN
  • RRALGRMVERSLRSELAALP
  • QRRGRAGR
  • QAKIHMPEKTAVEFLSKA
  • VFVRDSSQVHPLAVLL
  • VLATNIAET
  • RCLHPLLV
  • VDEVHER
  • YSEEEELVKGVLMAGLYPNLIQVRQGKVTRQGKFKPNS
  • GILLRKLQ
  • LTRDPFS
  • KKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYR
  • KLKSLGLVD
  • FLVGKPS
  • NPSLEGVSHV
  • AETSITI
  • GDTGCGK
  • SRENYLEENLLYAPSLRFIHGLIKQFSENIYEAFLVGKP
  • SRDLLKEFPQPKNLLNSVIGRALGISHA
  • KKKVTLHIKWPK
  • PEILRTPLE
  • SRWLTYFMAVKSNG
  • TVGTKTK
  • EAENKAAALAC
  • WQEAPQLPVDPHRDTIL
  • LPVHSNIPMMDQ
  • FLSMTQQDSH
  • TNIAETS
  • TQPRRISA
  • WPCPMTF
  • AIRALTQFPLPKNLLA
  • GEPGGILCFLPGWQEIKGVQQRL
  • VIQIATSSST
  • LLHKSTINREA

Post-translational modifications for DHX30 Gene

Domains & Families for DHX30 Gene

Gene Families for DHX30 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted secreted proteins

Suggested Antigen Peptide Sequences for DHX30 Gene

GenScript: Design optimal peptide antigens:
  • DEAH box protein 30 (DHX30_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q7L2E3

UniProtKB/Swiss-Prot:

DHX30_HUMAN :
  • Belongs to the DEAD box helicase family. DEAH subfamily.
Family:
  • Belongs to the DEAD box helicase family. DEAH subfamily.
genes like me logo Genes that share domains with DHX30: view

Function for DHX30 Gene

Molecular function for DHX30 Gene

UniProtKB/Swiss-Prot Function:
RNA-dependent helicase (PubMed:29100085). Plays an important role in the assembly of the mitochondrial large ribosomal subunit (PubMed:25683715, PubMed:29100085). Required for optimal function of the zinc-finger antiviral protein ZC3HAV1 (By similarity). Associates with mitochondrial DNA (PubMed:18063578). Involved in nervous system development and differentiation through its involvement in the up-regulation of a number of genes which are required for neurogenesis, including GSC, NCAM1, neurogenin, and NEUROD (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; EC=3.6.4.13; Evidence=. ;.

Enzyme Numbers (IUBMB) for DHX30 Gene

Phenotypes From GWAS Catalog for DHX30 Gene

Gene Ontology (GO) - Molecular Function for DHX30 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002151 G-quadruplex RNA binding IBA 21873635
GO:0003676 nucleic acid binding IEA --
GO:0003678 DNA helicase activity IBA 21873635
GO:0003682 chromatin binding IDA 18063578
GO:0003723 RNA binding IDA,IBA 29100085
genes like me logo Genes that share ontologies with DHX30: view
genes like me logo Genes that share phenotypes with DHX30: view

Human Phenotype Ontology for DHX30 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for DHX30 Gene

MGI Knock Outs for DHX30:
  • Dhx30 Dhx30<tm1.1(KOMP)Vlcg>

Animal Model Products

CRISPR Products

Clone Products

No data available for Transcription Factor Targets and HOMER Transcription for DHX30 Gene

Localization for DHX30 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DHX30 Gene

Cytoplasm. Mitochondrion. Mitochondrion matrix, mitochondrion nucleoid. Note=Localizes to mitochondrial RNA granules found in close proximity to the mitochondrial nucleoids (PubMed:16825194, PubMed:25683715). Relocalizes to stress granules upon heat stress (PubMed:29100085). {ECO:0000269 PubMed:16825194, ECO:0000269 PubMed:25683715, ECO:0000269 PubMed:29100085}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DHX30 gene
Compartment Confidence
mitochondrion 5
nucleus 4
cytosol 4

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Mitochondria (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for DHX30 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IBA 21873635
GO:0005737 cytoplasm IEA,IDA 29100085
GO:0005739 mitochondrion IDA,IEA 29100085
GO:0005829 cytosol IDA --
GO:0035770 ribonucleoprotein granule IDA 25683715
genes like me logo Genes that share ontologies with DHX30: view

Pathways & Interactions for DHX30 Gene

PathCards logo

SuperPathways for DHX30 Gene

No Data Available

Gene Ontology (GO) - Biological Process for DHX30 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0007417 central nervous system development ISS --
GO:0032508 DNA duplex unwinding IEA --
GO:0042254 ribosome biogenesis IEA --
GO:1902775 mitochondrial large ribosomal subunit assembly IMP 25683715
genes like me logo Genes that share ontologies with DHX30: view

No data available for Pathways by source and SIGNOR curated interactions for DHX30 Gene

Drugs & Compounds for DHX30 Gene

(3) Drugs for DHX30 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0

(1) Additional Compounds for DHX30 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor 58-64-0
genes like me logo Genes that share compounds with DHX30: view

Transcripts for DHX30 Gene

CRISPR Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for DHX30 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8a · 8b · 8c ^ 9a · 9b · 9c ^ 10 ^ 11a · 11b · 11c ^ 12a · 12b ^ 13 ^ 14a · 14b · 14c · 14d ^
SP1: - - - - -
SP2: - - - - - -
SP3: - - - - -
SP4: - - - -
SP5: - - - - -
SP6:
SP7: - - - -
SP8: - - - - -
SP9:
SP10:
SP11:
SP12:

ExUns: 15a · 15b ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21a · 21b ^ 22 ^ 23 ^ 24 ^ 25 ^ 26
SP1:
SP2:
SP3: - - - - - - - - - - - -
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:

Relevant External Links for DHX30 Gene

GeneLoc Exon Structure for
DHX30
ECgene alternative splicing isoforms for
DHX30

Expression for DHX30 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for DHX30 Gene

Protein differential expression in normal tissues from HIPED for DHX30 Gene

This gene is overexpressed in Bone marrow stromal cell (33.0) and Peripheral blood mononuclear cells (6.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for DHX30 Gene



Protein tissue co-expression partners for DHX30 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of DHX30 Gene:

DHX30

SOURCE GeneReport for Unigene cluster for DHX30 Gene:

Hs.517948

Evidence on tissue expression from TISSUES for DHX30 Gene

  • Nervous system(4.8)
  • Liver(4.3)
  • Skin(3.6)
  • Eye(2.9)
  • Lung(2.2)
genes like me logo Genes that share expression patterns with DHX30: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for DHX30 Gene

Orthologs for DHX30 Gene

This gene was present in the common ancestor of chordates.

Orthologs for DHX30 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia DHX30 33 32
  • 98.99 (n)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia -- 33
  • 97 (a)
OneToMany
-- 33
  • 83 (a)
OneToMany
dog
(Canis familiaris)
Mammalia DHX30 33 32
  • 91.74 (n)
OneToOne
cow
(Bos Taurus)
Mammalia DHX30 33 32
  • 91.22 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Dhx30 32
  • 90.23 (n)
oppossum
(Monodelphis domestica)
Mammalia DHX30 33
  • 90 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Dhx30 17 33 32
  • 89.15 (n)
chicken
(Gallus gallus)
Aves DHX30 33 32
  • 75.21 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia DHX30 33
  • 76 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia dhx30 32
  • 67.42 (n)
Str.344 32
zebrafish
(Danio rerio)
Actinopterygii dhx30 32
  • 58.56 (n)
DHX30 33
  • 48 (a)
OneToOne
Species where no ortholog for DHX30 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for DHX30 Gene

ENSEMBL:
Gene Tree for DHX30 (if available)
TreeFam:
Gene Tree for DHX30 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for DHX30: view image

Paralogs for DHX30 Gene

(2) SIMAP similar genes for DHX30 Gene using alignment to 3 proteins:

  • DHX30_HUMAN
  • F6R0H4_HUMAN
  • H7BXY3_HUMAN
genes like me logo Genes that share paralogs with DHX30: view

Variants for DHX30 Gene

Sequence variations from dbSNP and Humsavar for DHX30 Gene

SNP ID Clin Chr 03 pos Variation AA Info Type
rs1057519436 pathogenic, Microcephaly, Oculomotor apraxia, Seizures, Short stature, Strabismus, Unsteady gait, NEURODEVELOPMENTAL DISORDER WITH SEVERE MOTOR IMPAIRMENT AND ABSENT LANGUAGE, Neurodevelopmental disorder with severe motor impairment and absent language (NEDMIAL) [MIM:617804] 47,846,550(+) G/A coding_sequence_variant, genic_downstream_transcript_variant, missense_variant
rs1060499733 pathogenic, Delayed speech and language development, Global developmental delay, Hearing impairment, Microcephaly, Muscular hypotonia of the trunk, Sleep disturbance, Strabismus, NEURODEVELOPMENTAL DISORDER WITH SEVERE MOTOR IMPAIRMENT AND ABSENT LANGUAGE, Neurodevelopmental disorder with severe motor impairment and absent language (NEDMIAL) [MIM:617804] 47,846,757(+) A/G coding_sequence_variant, genic_downstream_transcript_variant, missense_variant
rs1085307451 pathogenic, not provided, NEURODEVELOPMENTAL DISORDER WITH SEVERE MOTOR IMPAIRMENT AND ABSENT LANGUAGE, Neurodevelopmental disorder with severe motor impairment and absent language (NEDMIAL) [MIM:617804] 47,848,246(+) C/T coding_sequence_variant, genic_downstream_transcript_variant, missense_variant
rs1553706775 pathogenic, NEURODEVELOPMENTAL DISORDER WITH SEVERE MOTOR IMPAIRMENT AND ABSENT LANGUAGE, Neurodevelopmental disorder with severe motor impairment and absent language (NEDMIAL) [MIM:617804] 47,848,235(+) G/A coding_sequence_variant, genic_downstream_transcript_variant, missense_variant
rs1553706799 pathogenic, NEURODEVELOPMENTAL DISORDER WITH SEVERE MOTOR IMPAIRMENT AND ABSENT LANGUAGE, Neurodevelopmental disorder with severe motor impairment and absent language (NEDMIAL) [MIM:617804] 47,848,247(+) G/A coding_sequence_variant, genic_downstream_transcript_variant, missense_variant

Structural Variations from Database of Genomic Variants (DGV) for DHX30 Gene

Variant ID Type Subtype PubMed ID
esv3561844 CNV deletion 23714750
nsv1006560 CNV gain 25217958
nsv10270 CNV gain 18304495
nsv1136722 CNV deletion 24896259
nsv231 CNV insertion 15895083
nsv3808 CNV insertion 18451855
nsv472381 CNV novel sequence insertion 20440878
nsv473806 CNV novel sequence insertion 20440878
nsv508916 CNV insertion 20534489
nsv834679 CNV loss 17160897

Variation tolerance for DHX30 Gene

Residual Variation Intolerance Score: 1.75% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.94; 19.40% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for DHX30 Gene

Human Gene Mutation Database (HGMD)
DHX30
SNPedia medical, phenotypic, and genealogical associations of SNPs for
DHX30

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DHX30 Gene

Disorders for DHX30 Gene

MalaCards: The human disease database

(6) MalaCards diseases for DHX30 Gene - From: HGMD, OMIM, ClinVar, and GeneCards

- elite association - COSMIC cancer census association via MalaCards
Search DHX30 in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

DHX30_HUMAN
  • Neurodevelopmental disorder with severe motor impairment and absent language (NEDMIAL) [MIM:617804]: An autosomal dominant neurodevelopmental disorder characterized by global developmental delay, intellectual disability, severe speech impairment and gait abnormalities. {ECO:0000269 PubMed:28327206, ECO:0000269 PubMed:29100085}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Additional Disease Information for DHX30

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with DHX30: view

No data available for Genatlas for DHX30 Gene

Publications for DHX30 Gene

  1. Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10048485) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1998) 2 3 4 56
  2. De Novo Missense Mutations in DHX30 Impair Global Translation and Cause a Neurodevelopmental Disorder. (PMID: 29100085) Lessel D … Kreienkamp HJ (American journal of human genetics 2017) 3 4 56
  3. Mitochondrial RNA Granules Are Centers for Posttranscriptional RNA Processing and Ribosome Biogenesis. (PMID: 25683715) Antonicka H … Shoubridge EA (Cell reports 2015) 3 4 56
  4. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 43 56
  5. The layered structure of human mitochondrial DNA nucleoids. (PMID: 18063578) Bogenhagen DF … Burke S (The Journal of biological chemistry 2008) 3 4 56

Products for DHX30 Gene

Sources for DHX30 Gene