This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of spli... See more...

Aliases for DDX5 Gene

Aliases for DDX5 Gene

  • DEAD-Box Helicase 5 2 3 5
  • DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 5 (RNA Helicase, 68kD) 2 3
  • DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 2 3
  • Probable ATP-Dependent RNA Helicase DDX5 3 4
  • DEAD (Asp-Glu-Ala-Asp) Box Helicase 5 2 3
  • DEAD Box Protein 5 3 4
  • RNA Helicase P68 3 4
  • G17P1 3 4
  • HLR1 3 4
  • P68 2 3
  • ATP-Dependent RNA Helicase DDX5 3
  • EC 3.6.4.13 4
  • DEAD Box-5 3
  • EC 3.6.1 50
  • HUMP68 3
  • DDX5 5
  • HELR 4

External Ids for DDX5 Gene

Previous HGNC Symbols for DDX5 Gene

  • HLR1
  • G17P1

Previous GeneCards Identifiers for DDX5 Gene

  • GC17M065876
  • GC17P068976
  • GC17M062913
  • GC17M063045
  • GC17M059926
  • GC17M062494
  • GC17M057943

Summaries for DDX5 Gene

Entrez Gene Summary for DDX5 Gene

  • This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. Members of this family contain nine conserved motifs, including the conserved Asp-Glu-Ala-Asp (DEAD) motif, important to ATP binding and hydrolysis as well as RNA binding and unwinding activities. Dysregulation of this gene may play a role in cancer development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2017]

GeneCards Summary for DDX5 Gene

DDX5 (DEAD-Box Helicase 5) is a Protein Coding gene. Diseases associated with DDX5 include Lung Cancer and Cartilage-Hair Hypoplasia. Among its related pathways are Proteoglycans in cancer and Transcriptional misregulation in cancer. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and enzyme binding. An important paralog of this gene is DDX17.

UniProtKB/Swiss-Prot Summary for DDX5 Gene

  • Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for androgen receptor AR but probably not ESR1. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specific manner; the function probably involves association with histone deacetylases, such as HDAC1. As component of a large PER complex is involved in the inhibition of 3' transcriptional termination of circadian target genes such as PER1 and NR1D1 and the control of the circadian rhythms.

Gene Wiki entry for DDX5 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for DDX5 Gene

Genomics for DDX5 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for DDX5 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around DDX5 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for DDX5

Top Transcription factor binding sites by QIAGEN in the DDX5 gene promoter:
  • C/EBPalpha
  • E2F
  • E2F-1
  • E2F-2
  • E2F-3a
  • E2F-4
  • E2F-5
  • E47
  • Evi-1
  • p53

Genomic Locations for DDX5 Gene

Latest Assembly
chr17:64,498,254-64,508,199
(GRCh38/hg38)
Size:
9,946 bases
Orientation:
Minus strand

Previous Assembly
chr17:62,494,372-62,502,984
(GRCh37/hg19 by Entrez Gene)
Size:
8,613 bases
Orientation:
Minus strand

chr17:62,495,734-62,504,317
(GRCh37/hg19 by Ensembl)
Size:
8,584 bases
Orientation:
Minus strand

Genomic View for DDX5 Gene

Genes around DDX5 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DDX5 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DDX5 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DDX5 Gene

Proteins for DDX5 Gene

  • Protein details for DDX5 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P17844-DDX5_HUMAN
    Recommended name:
    Probable ATP-dependent RNA helicase DDX5
    Protein Accession:
    P17844
    Secondary Accessions:
    • B4DLW8
    • B5BU21
    • D3DU32
    • E7ETL9
    • O75681
    • Q53Y61

    Protein attributes for DDX5 Gene

    Size:
    614 amino acids
    Molecular mass:
    69148 Da
    Quaternary structure:
    • Identified in the spliceosome C complex. Interacts with RBM4; the interaction occurs in an RNA-independent manner. Interacts with AGO1 and AGO2. Interacts with ESR1, AR, EP300, CREBBP, POLR2A, TP53, RUNX2 and HDAC1. Self-associates. Interacts with DDX17. Interacts with BRDT. The large PER complex involved in the repression of transcriptional termination is composed of at least PER2, CDK9, DDX5, DHX9, NCBP1 and POLR2A (active). Interacts with DHX36; this interaction occurs in a RNA-dependent manner (PubMed:18279852). Interacts with NUPR1 (By similarity). Interacts with ERCC6 (PubMed:26030138). Interacts with DDX3X in the cytoplasm; this interaction may be more efficient when both proteins are unphosphorylated (PubMed:22034099).

    Three dimensional structures from OCA and Proteopedia for DDX5 Gene

    Alternative splice isoforms for DDX5 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DDX5 Gene

Selected DME Specific Peptides for DDX5 Gene

P17844:
  • MRRDGWPAM
  • DMGFEPQ
  • YGGAPKG
  • DEADRML
  • VASRGLD
  • PTRELAQQ
  • VLDEADRM
  • VFVETKR
  • TDVASRG
  • NMHNGMNQQAYAYP
  • QLAEDFL
  • KKFGNPGE
  • LPAIVHIN
  • AQTGSGKT
  • FVETKRRCD
  • LAPTREL
  • HRIGRTAR
  • LELSANHNILQIVDVC
  • TGSGKTLS
  • TPGRLID
  • ILIATDVA
  • LVLDEADR
  • TYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIAR
  • MWSATWPK
  • FEKNFYQEHPD
  • QIRPDRQT
  • IHGDKSQ
  • SATWPKEV
  • VLREANQ
  • APTRELA
  • YSSDRDRGRDRGFGAPRFGGSR
  • GPQIRDL
  • GKTNLRR
  • IATPGRL
  • PKFEKNFY
  • EANQAINPKL
  • YIHRIGR

Post-translational modifications for DDX5 Gene

  • Arg-502 is dimethylated, probably to asymmetric dimethylarginine.
  • Sumoylated; sumoylation, promoted by PIAS1, promotes interaction with HDAC1 and transcriptional repression activity. Sumoylation also significantly increases stability, and reduces polyubiquitination.
  • Polyubiquitinated, leading to proteasomal degradation.
  • Weakly phosphorylated in the G1/S phase of the cell cycle and much more at G2/M, especially at Thr and Tyr residues.
  • Ubiquitination at Lys56, Lys91, Lys236, Lys340, Lys351, Lys375, Lys388, Lys411, Lys437, Lys451, Lys470, and Lys529
  • Modification sites at PhosphoSitePlus

Antibodies for research

  • Abcam antibodies for DDX5

Domains & Families for DDX5 Gene

Gene Families for DDX5 Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for DDX5 Gene

Suggested Antigen Peptide Sequences for DDX5 Gene

GenScript: Design optimal peptide antigens:
  • ATP-dependent RNA helicase DDX5 (B5BUE6_HUMAN)
  • RNA helicase p68 (DDX5_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P17844

UniProtKB/Swiss-Prot:

DDX5_HUMAN :
  • Belongs to the DEAD box helicase family. DDX5/DBP2 subfamily.
Family:
  • Belongs to the DEAD box helicase family. DDX5/DBP2 subfamily.
genes like me logo Genes that share domains with DDX5: view

Function for DDX5 Gene

Molecular function for DDX5 Gene

UniProtKB/Swiss-Prot Function:
Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for androgen receptor AR but probably not ESR1. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specific manner; the function probably involves association with histone deacetylases, such as HDAC1. As component of a large PER complex is involved in the inhibition of 3' transcriptional termination of circadian target genes such as PER1 and NR1D1 and the control of the circadian rhythms.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; EC=3.6.4.13;.
GENATLAS Biochemistry:
DEAD/H box protein 5,putative RNA helicase

Enzyme Numbers (IUBMB) for DDX5 Gene

Phenotypes From GWAS Catalog for DDX5 Gene

Gene Ontology (GO) - Molecular Function for DDX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0003676 nucleic acid binding IEA --
GO:0003723 RNA binding IEA,IBA 21873635
GO:0003724 RNA helicase activity IEA,NAS 1996094
GO:0003730 mRNA 3'-UTR binding IDA 23788676
genes like me logo Genes that share ontologies with DDX5: view
genes like me logo Genes that share phenotypes with DDX5: view

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DDX5

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for DDX5 Gene

Localization for DDX5 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DDX5 Gene

Nucleus. Nucleus, nucleolus. Cytoplasm. Note=During the G0 phase, predominantly located in the nucleus. Cytoplasmic levels increase during the G1/S phase. During the M phase, located at the vicinity of the condensed chromosomes. At G1, localizes in the cytoplasm. {ECO:0000269 PubMed:22034099}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DDX5 gene
Compartment Confidence
nucleus 5
extracellular 4
cytoskeleton 2
mitochondrion 2
cytosol 2
plasma membrane 1
peroxisome 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoli (3)
  • Nucleoplasm (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for DDX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,NAS 2451786
GO:0005654 nucleoplasm IDA,TAS --
GO:0005681 spliceosomal complex IEA --
GO:0005730 nucleolus IDA 10837141
GO:0005737 cytoplasm IEA,IBA 21873635
genes like me logo Genes that share ontologies with DDX5: view

Pathways & Interactions for DDX5 Gene

genes like me logo Genes that share pathways with DDX5: view

Pathways by source for DDX5 Gene

SIGNOR curated interactions for DDX5 Gene

Activates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for DDX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription by RNA polymerase II IDA 15298701
GO:0000380 alternative mRNA splicing, via spliceosome IMP 24275493
GO:0000381 regulation of alternative mRNA splicing, via spliceosome IMP 23022728
GO:0000398 mRNA splicing, via spliceosome TAS --
GO:0000956 nuclear-transcribed mRNA catabolic process IDA 23788676
genes like me logo Genes that share ontologies with DDX5: view

Drugs & Compounds for DDX5 Gene

(7) Drugs for DDX5 Gene - From: DrugBank, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Dihydroartemisinin Approved, Experimental, Investigational Pharma Target, ligand 123
Water Approved Pharma 0
Phosphate Experimental Pharma 0
ATP Investigational Nutra 0

(2) Additional Compounds for DDX5 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
58-64-0
genes like me logo Genes that share compounds with DDX5: view

Transcripts for DDX5 Gene

mRNA/cDNA for DDX5 Gene

4 REFSEQ mRNAs :
24 NCBI additional mRNA sequence :
41 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DDX5

Alternative Splicing Database (ASD) splice patterns (SP) for DDX5 Gene

ExUns: 1 ^ 2a · 2b ^ 3a · 3b · 3c ^ 4 ^ 5a · 5b · 5c ^ 6a · 6b · 6c ^ 7a · 7b · 7c ^ 8a · 8b ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12a · 12b · 12c ·
SP1: - - - -
SP2:
SP3: - - -
SP4: - - -
SP5:
SP6: -
SP7:
SP8:
SP9:
SP10:
SP11:
SP12: - - - - - - - - - - - - - -
SP13: - - - -
SP14: -
SP15: -
SP16:
SP17:
SP18:
SP19:

ExUns: 12d · 12e · 12f ^ 13 ^ 14a · 14b · 14c · 14d · 14e ^ 15a · 15b ^ 16 ^ 17a · 17b · 17c · 17d ^ 18a · 18b · 18c · 18d
SP1: - - - - - - - - - -
SP2: - - - - - - - - -
SP3:
SP4:
SP5:
SP6:
SP7: - - -
SP8: - - - -
SP9: - - - - - - - -
SP10: - - - - - - -
SP11: - -
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:
SP18: - -
SP19:

Relevant External Links for DDX5 Gene

GeneLoc Exon Structure for
DDX5

Expression for DDX5 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for DDX5 Gene

Protein differential expression in normal tissues from HIPED for DDX5 Gene

This gene is overexpressed in Lymph node (13.1) and Peripheral blood mononuclear cells (7.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for DDX5 Gene



Protein tissue co-expression partners for DDX5 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for DDX5

SOURCE GeneReport for Unigene cluster for DDX5 Gene:

Hs.279806

Evidence on tissue expression from TISSUES for DDX5 Gene

  • Nervous system(5)
  • Blood(4.9)
  • Lung(4.8)
  • Kidney(4.6)
  • Spleen(4.6)
  • Liver(4.6)
  • Muscle(4.6)
  • Intestine(4.6)
  • Skin(4.5)
  • Pancreas(4.5)
  • Eye(4.1)
  • Stomach(4.1)
  • Heart(3.6)
  • Bone marrow(3.2)
  • Lymph node(3.2)
  • Bone(3)
  • Thyroid gland(3)
  • Adrenal gland(2.6)
  • Gall bladder(2.5)
genes like me logo Genes that share expression patterns with DDX5: view

Primer products for research

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for DDX5 Gene

Orthologs for DDX5 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for DDX5 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia DDX5 29 30
  • 99.57 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia -- 30
  • 98 (a)
OneToMany
-- 30
  • 94 (a)
OneToMany
Dog
(Canis familiaris)
Mammalia DDX5 29 30
  • 96.63 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia DDX5 29 30
  • 95.49 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Ddx5 29 16 30
  • 94.08 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Ddx5 29
  • 94.08 (n)
Oppossum
(Monodelphis domestica)
Mammalia DDX5 30
  • 89 (a)
OneToOne
Chicken
(Gallus gallus)
Aves DDX5 29 30
  • 83.11 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia -- 30
  • 89 (a)
OneToMany
-- 30
  • 82 (a)
OneToMany
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia ddx5 29
  • 74.51 (n)
MGC76265 29
African clawed frog
(Xenopus laevis)
Amphibia Xl.648 29
Zebrafish
(Danio rerio)
Actinopterygii ddx5 29 30
  • 73.59 (n)
OneToOne
Dr.28420 29
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.10528 29
Fruit Fly
(Drosophila melanogaster)
Insecta CG10077 29 30 31
  • 59.93 (n)
ManyToMany
Rm62 30 31
  • 45 (a)
ManyToMany
CG10777 30 31
  • 34 (a)
ManyToMany
CG14443 31
  • 32 (a)
Worm
(Caenorhabditis elegans)
Secernentea F58E10.3 31
  • 59 (a)
ddx-17 30
  • 50 (a)
OneToMany
F58G11.2 31
  • 30 (a)
K. Lactis Yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0F23716g 29
  • 61.02 (n)
A. gosspyii yeast
(Eremothecium gossypii)
Saccharomycetes AGOS_AFL221C 29
  • 58.42 (n)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes DBP2 29 30 32
  • 57.99 (n)
OneToMany
Thale Cress
(Arabidopsis thaliana)
eudicotyledons AT1G55150 29
  • 60.09 (n)
Barley
(Hordeum vulgare)
Liliopsida Hv.9145 29
Fission Yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes dbp2 29
  • 58.94 (n)
Bread mold
(Neurospora crassa)
Ascomycetes NCU07839 29
  • 57.72 (n)
Species where no ortholog for DDX5 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for DDX5 Gene

ENSEMBL:
Gene Tree for DDX5 (if available)
TreeFam:
Gene Tree for DDX5 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for DDX5: view image
Alliance of Genome Resources:
Additional Orthologs for DDX5

Paralogs for DDX5 Gene

(26) SIMAP similar genes for DDX5 Gene using alignment to 17 proteins:

  • DDX5_HUMAN
  • B4DLW8_HUMAN
  • B5BUE6_HUMAN
  • J3KRX8_HUMAN
  • J3KRZ1_HUMAN
  • J3KTA4_HUMAN
  • J3KTQ4_HUMAN
  • J3QKN9_HUMAN
  • J3QLG9_HUMAN
  • J3QR02_HUMAN
  • J3QR62_HUMAN
  • J3QRN5_HUMAN
  • J3QRQ7_HUMAN
  • J3QS79_HUMAN
  • J3QS97_HUMAN
  • J3QSF1_HUMAN
  • K7EKV0_HUMAN

Pseudogenes.org Pseudogenes for DDX5 Gene

genes like me logo Genes that share paralogs with DDX5: view

Variants for DDX5 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for DDX5 Gene

SNP ID Clinical significance and condition Chr 17 pos Variation AA Info Type
rs35390502 Benign: not provided 64,503,194(-) T/C
NM_004396.5(DDX5):c.804A>G (p.Gln268=)
SYNONYMOUS
rs1140409 -- p.Ser480Ala

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for DDX5 Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for DDX5 Gene

Variant ID Type Subtype PubMed ID
nsv475380 CNV novel sequence insertion 20440878

Variation tolerance for DDX5 Gene

Residual Variation Intolerance Score: 9.84% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.19; 51.99% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for DDX5 Gene

Human Gene Mutation Database (HGMD)
DDX5
SNPedia medical, phenotypic, and genealogical associations of SNPs for
DDX5
Leiden Open Variation Database (LOVD)
DDX5

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DDX5 Gene

Disorders for DDX5 Gene

MalaCards: The human disease database

(2) MalaCards diseases for DDX5 Gene - From: COP and GCD

Disorder Aliases PubMed IDs
lung cancer
  • lung cancer, susceptibility to
cartilage-hair hypoplasia
  • chh
- elite association - COSMIC cancer census association via MalaCards
Search DDX5 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for DDX5

Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform
genes like me logo Genes that share disorders with DDX5: view

No data available for UniProtKB/Swiss-Prot and Genatlas for DDX5 Gene

Publications for DDX5 Gene

  1. Sumoylation of p68 and p72 RNA helicases affects protein stability and transactivation potential. (PMID: 19995069) Mooney SM … Janknecht R (Biochemistry 2010) 3 4 22
  2. The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer. (PMID: 19718048) Wortham NC … Fuller-Pace FV (Oncogene 2009) 3 4 22
  3. P68 RNA helicase (DDX5) alters activity of cis- and trans-acting factors of the alternative splicing of H-Ras. (PMID: 18698352) Camats M … Bach-Elias M (PloS one 2008) 2 3 22
  4. Transcription-dependent nucleolar cap localization and possible nuclear function of DExH RNA helicase RHAU. (PMID: 18279852) Iwamoto F … Nagamine Y (Experimental cell research 2008) 3 4 22
  5. p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. (PMID: 17960593) Jensen ED … Westendorf JJ (Journal of cellular biochemistry 2008) 3 4 22

Products for DDX5 Gene