Free for academic non-profit institutions. Other users need a Commercial license
This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. [provided by RefSeq, Jul 2008] See more...
Aliases for DDAH1 Gene
Aliases for DDAH1 Gene
External Ids for DDAH1 Gene
- HGNC: 2715
- NCBI Entrez Gene: 23576
- Ensembl: ENSG00000153904
- OMIM®: 604743
- UniProtKB/Swiss-Prot: O94760
Previous GeneCards Identifiers for DDAH1 Gene
- GC01M086186
- GC01M084928
- GC01M085072
- GC01M085206
- GC01M085496
- GC01M085785
- GC01M083894
Summaries for DDAH1 Gene
-
This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. [provided by RefSeq, Jul 2008]
GeneCards Summary for DDAH1 Gene
DDAH1 (Dimethylarginine Dimethylaminohydrolase 1) is a Protein Coding gene. Diseases associated with DDAH1 include Cardiovascular System Disease and Pulmonary Hypertension. Among its related pathways are Mesodermal Commitment Pathway and eNOS activation and regulation. Gene Ontology (GO) annotations related to this gene include amino acid binding and dimethylargininase activity. An important paralog of this gene is DDAH2.
UniProtKB/Swiss-Prot Summary for DDAH1 Gene
-
Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
Additional gene information for DDAH1 Gene
- HGNC (2715)
- NCBI Entrez Gene (23576)
- Ensembl (ENSG00000153904)
- OMIM® (604743)
- UniProtKB/Swiss-Prot (O94760)
- Open Targets Platform(ENSG00000153904)
- Monarch Initiative
- Search for DDAH1 at DataMed
- Search for DDAH1 at HumanCyc
No data available for CIViC Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for DDAH1 Gene
Genomics for DDAH1 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for DDAH1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around DDAH1 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for DDAH1
- Top Transcription factor binding sites by QIAGEN in the DDAH1 gene promoter:
-
- E2F
- E2F-1
- E2F-2
- E2F-3a
- E2F-4
- E2F-5
- SRF
- SRF (504 AA)
Genomic Locations for DDAH1 Gene
Latest Assembly
- chr1:85,318,481-85,578,363
- (GRCh38/hg38)
- Size:
- 259,883 bases
- Orientation:
- Minus strand
Previous Assembly
- chr1:85,784,168-86,043,883
- (GRCh37/hg19 by Entrez Gene)
- Size:
- 259,716 bases
- Orientation:
- Minus strand
- chr1:85,784,164-86,043,933
- (GRCh37/hg19 by Ensembl)
- Size:
- 259,770 bases
- Orientation:
- Minus strand
Genomic View for DDAH1 Gene
Genes around DDAH1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 1p22.3 by HGNC
- 1p22.3 by Entrez Gene
- 1p22.3 by Ensembl
DDAH1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for DDAH1 Gene
Proteins for DDAH1 Gene
-
Protein details for DDAH1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- O94760-DDAH1_HUMAN
- Recommended name:
- N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
- Protein Accession:
- O94760
- Q5HYC8
- Q86XK5
Protein attributes for DDAH1 Gene
- Size:
- 285 amino acids
- Molecular mass:
- 31122 Da
- Quaternary structure:
-
- Monomer.
Three dimensional structures from OCA and Proteopedia for DDAH1 Gene
Protein Expression for DDAH1 Gene
Selected DME Specific Peptides for DDAH1 Gene
- O94760:
-
- AANCIYLNIP
- DVLFTGREFFVGLSK
- DENATLDG
- AVSTVPV
- LHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDK
Post-translational modifications for DDAH1 Gene
Other Protein References for DDAH1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibodies for research
- LifeSpan BioSciences DDAH1 Antibody (LS-B5858) and DDAH1 Antibody (LS-B5857)
- NSJ Bioreagents DDAH1 Antibody
- Novus Biologicals Antibodies for DDAH1
-
Abcam antibodies for DDAH1
- Invitrogen Antibodies for DDAH1 (AFLGC-DDAH1)
-
Santa Cruz Biotechnology (SCBT) Antibodies for DDAH1
- Sino Biological Antibodies for DDAH1
Protein products for research
- Search Origene for MassSpec and Protein Over-expression Lysates for DDAH1
- Origene Custom Protein Services for DDAH1
- ProSpec Recombinant Proteins for DDAH1
-
Abcam proteins for DDAH1
Assay products for research
- RayBiotech Custom Human DDAH1 ELISA
- antibodies-online: Show 18 available DDAH1 Elisa Kits ranked by validation data
- Compare Top DDAH1 Elisa Kits
-
Quality Products:
Domains & Families for DDAH1 Gene
Gene Families for DDAH1 Gene
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Plasma proteins
- Predicted intracellular proteins
Suggested Antigen Peptide Sequences for DDAH1 Gene
- GenScript: Design optimal peptide antigens:
-
- cDNA, FLJ92778, Homo sapiens dimethylarginine dimethylaminohydrolase 1 (DDAH1), mRNA (B1AKK2_HUMAN)
- cDNA FLJ54083, highly similar to NG,NG-dimethylarginine dimethylaminohydrolase 1 (EC 3.5.3.18) (B4DGT0_HUMAN)
- cDNA FLJ54119, highly similar to NG,NG-dimethylarginine dimethylaminohydrolase 1 (EC 3.5.3.18) (B4DYP1_HUMAN)
- Dimethylargininase-1 (DDAH1_HUMAN)
Graphical View of Domain Structure for InterPro Entry
O94760- Family:
-
- Belongs to the DDAH family.
Function for DDAH1 Gene
Molecular function for DDAH1 Gene
- UniProtKB/Swiss-Prot Function:
- Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=H2O + N(omega),N(omega)-dimethyl-L-arginine = dimethylamine + L-citrulline; Xref=Rhea:RHEA:17305, ChEBI:CHEBI:15377, ChEBI:CHEBI:57743, ChEBI:CHEBI:58040, ChEBI:CHEBI:58326; EC=3.5.3.18; Evidence={ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506};.
- UniProtKB/Swiss-Prot BiophysicochemicalProperties:
- Kinetic parameters: KM=69 uM for asymmetric dimethylarginine (ADMA) {ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506}; KM=54 uM for monomethyl-L-arginine (MMA) {ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506}; KM=3.1 uM for S-methyl-L-thiocitrulline {ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506}; Vmax=356 nmol/min/mg enzyme with ADMA {ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506}; Vmax=154 nmol/min/mg enzyme with NMA {ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506}; pH dependence: Optimum pH is 8.5. {ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506};
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Inhibited by zinc ions (By similarity). Enzyme purified in the absence of 1,10-phenanthroline contains on average 0.4 zinc atoms per subunit. Inhibited by 4-hydroxy-nonenal through the formation of a covalent adduct with His-173. Competitively inhibited by N(5)-iminopropyl-ornithine.
- GENATLAS Biochemistry:
- N-omega,N-omega dimethylarginine dimethylaminohydrolase 1
Enzyme Numbers (IUBMB) for DDAH1 Gene
Phenotypes From GWAS Catalog for DDAH1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0003824 | catalytic activity | TAS | 9874257 |
| GO:0016403 | dimethylargininase activity | IEA,IDA | 19663506 |
| GO:0016597 | amino acid binding | IBA | 21873635 |
| GO:0016787 | hydrolase activity | IEA | -- |
| GO:0046872 | metal ion binding | IEA | -- |
Phenotypes for DDAH1 Gene
- MGI mutant phenotypes for DDAH1:
- inferred from 6 alleles
- GenomeRNAi human phenotypes for DDAH1:
-
- Increased gamma-H2AX phosphorylation
- no effect
- Decreased vaccinia virus (VACV) infection
- Decreased viability
- FOXO1 nuclear localization
- Resistant to vaccinia virus (VACV-A4L) infection
- Decreased shRNA abundance (Z-score < -2)
- Increased shRNA abundance (Z-score > 2)
- Synthetic lethal with imatinib mesylate
Animal Models for DDAH1 Gene
Animal Models for research
-
Taconic Biosciences Mouse Models for DDAH1
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for DDAH1 - Starting at $85 >
- * DDAH1 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for DDAH1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for DDAH1
-
Santa Cruz Biotechnology (SCBT) CRISPR for DDAH1
miRNA for DDAH1 Gene
- miRTarBase miRNAs that target DDAH1
-
- hsa-miR-210-3p (MIRT003179)
- mmu-miR-758-3p (MIRT007557)
- mmu-miR-7b-5p (MIRT009179)
- mmu-miR-190a-5p (MIRT013590)
- hsa-miR-30b-5p (MIRT023452)
- hsa-miR-34a-5p (MIRT025359)
- hsa-miR-21-5p (MIRT030838)
- hsa-miR-18a-3p (MIRT040900)
- hsa-miR-221-3p (MIRT046866)
- hsa-miR-100-5p (MIRT048463)
- hsa-miR-92a-3p (MIRT049248)
- hsa-miR-18a-5p (MIRT050653)
- hsa-miR-1261 (MIRT346624)
- hsa-miR-5096 (MIRT478378)
- hsa-miR-377-3p (MIRT478379)
- hsa-miR-4775 (MIRT478380)
- hsa-miR-196a-3p (MIRT478381)
- hsa-miR-3128 (MIRT478382)
- hsa-miR-1228-3p (MIRT478383)
- hsa-miR-892b (MIRT478384)
- hsa-miR-193b-3p (MIRT478385)
- hsa-miR-193a-3p (MIRT478386)
- hsa-miR-590-3p (MIRT478387)
- hsa-miR-6509-5p (MIRT538141)
- hsa-miR-374b-3p (MIRT538142)
- hsa-miR-331-5p (MIRT538143)
- hsa-miR-4766-3p (MIRT538144)
- hsa-miR-140-3p (MIRT538145)
- hsa-miR-548p (MIRT538146)
- hsa-miR-411-5p (MIRT538147)
- hsa-miR-585-5p (MIRT538148)
- hsa-miR-891a-3p (MIRT538149)
- hsa-miR-376a-2-5p (MIRT538150)
- hsa-miR-5693 (MIRT538151)
- hsa-miR-936 (MIRT538152)
- hsa-miR-30e-5p (MIRT538153)
- hsa-miR-30c-5p (MIRT538154)
- hsa-miR-30d-5p (MIRT538155)
- hsa-miR-30a-5p (MIRT538156)
- hsa-miR-128-3p (MIRT538157)
- hsa-miR-3681-3p (MIRT538158)
- hsa-miR-216a-3p (MIRT538159)
- hsa-miR-29b-2-5p (MIRT558442)
- hsa-miR-376c-5p (MIRT558443)
- hsa-miR-376b-5p (MIRT558444)
- hsa-miR-509-3p (MIRT558445)
- hsa-miR-759 (MIRT558446)
- hsa-miR-6849-5p (MIRT558447)
- hsa-miR-4797-5p (MIRT558448)
- hsa-miR-3681-5p (MIRT558449)
- hsa-miR-3910 (MIRT558450)
- hsa-miR-548an (MIRT558451)
- hsa-miR-182-5p (MIRT558452)
- hsa-miR-183-5p (MIRT558453)
- hsa-miR-1271-5p (MIRT558454)
- hsa-miR-96-5p (MIRT558455)
- hsa-miR-5696 (MIRT568752)
- hsa-miR-4729 (MIRT568753)
- hsa-miR-579-3p (MIRT751499)
- hsa-miR-664b-3p (MIRT753610)
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DDAH1
- Browse OriGene Inhibitory RNA Products For DDAH1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DDAH1
Clone products for research
- Applied Biological Materials (abm): Clones for DDAH1 - Starting at $45 >
- * DDAH1 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for DDAH1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for DDAH1
Cell Lines for research
-
Horizon Cell Lines for DDAH1
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for DDAH1 Gene
Localization for DDAH1 Gene
| Compartment | Confidence |
|---|---|
| cytosol | 5 |
| extracellular | 4 |
| plasma membrane | 3 |
| nucleus | 3 |
| cytoskeleton | 2 |
| mitochondrion | 2 |
| peroxisome | 1 |
| endoplasmic reticulum | 1 |
| endosome | 1 |
| lysosome | 1 |
| golgi apparatus | 1 |
- Cytosol (2)
- Nucleoli (2)
- Plasma membrane (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005829 | cytosol | TAS | -- |
| GO:0070062 | extracellular exosome | HDA | 19056867 |
No data available for Subcellular locations from UniProtKB/Swiss-Prot for DDAH1 Gene
Pathways & Interactions for DDAH1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | eNOS activation and regulation |
.01
|
|
| 2 | Mesodermal Commitment Pathway | ||
| 3 | Metabolism |
.40
|
|
Pathways by source for DDAH1 Gene
2 BioSystems pathways for DDAH1 Gene
4 Reactome pathways for DDAH1 Gene
Interacting Proteins for DDAH1 Gene
GPS-Prot Interaction Network for DDAH1
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000052 | citrulline metabolic process | IEA,IDA | 19663506 |
| GO:0003073 | regulation of systemic arterial blood pressure | ISS | -- |
| GO:0006525 | arginine metabolic process | IBA | 21873635 |
| GO:0006527 | arginine catabolic process | IEA,IDA | 24895913 |
| GO:0007263 | nitric oxide mediated signal transduction | TAS | 9874257 |
No data available for SIGNOR curated interactions for DDAH1 Gene
Drugs & Compounds for DDAH1 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Dexlansoprazole | Approved, Investigational | Pharma | Target | 262 | ||
| Esomeprazole | Approved, Investigational | Pharma | Target | Proton pump inhibitor | 427 | |
| Pantoprazole | Approved | Pharma | Target, inhibitor | H+/K+-ATPase inhibitor | 210 | |
| Water | Approved | Pharma | 0 | |||
| N,N-dimethylarginine | Experimental | Pharma | 24 |
Transcripts for DDAH1 Gene
mRNA/cDNA for DDAH1 Gene
- 3 REFSEQ mRNAs :
- 16 NCBI additional mRNA sequence :
- 3 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000284031 3939 nts (view in UCSC)
- ENST00000426972 4022 nts (view in UCSC)
- ENST00000633113 703 nts (view in UCSC)
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for DDAH1 - Starting at $85 >
- * DDAH1 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for DDAH1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for DDAH1
-
Santa Cruz Biotechnology (SCBT) CRISPR for DDAH1
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DDAH1
- Browse OriGene Inhibitory RNA Products For DDAH1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DDAH1
Clone products for research
- Applied Biological Materials (abm): Clones for DDAH1 - Starting at $45 >
- * DDAH1 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for DDAH1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for DDAH1
Relevant External Links for DDAH1 Gene
- GeneLoc Exon Structure for
- DDAH1
Expression for DDAH1 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Brain (Nervous System)
- Neural Tube (Nervous System)
- Inner Cell Mass (Early Embryonic Tissues)
-
Blood (Cardiovascular System)
- Primitive Erythrocytes Extraembryonic Blood Islands
- Hematopoietic Stem Cells Hematopoietic Bone Marrow
- Tooth (Integumentary System)
-
Eye (Sensory Organs)
- GABAergic Amacrine Cells Inner Nuclear Layer
-
Neurons
- GABAergic Amacrine Cells Inner Nuclear Layer
-
Kidney (Urinary System)
- Presumptive Podocytes Podocyte Layer
-
Epithelial Cells
- Presumptive Podocytes Podocyte Layer
-
Extraembryonic Mesoderm (Extraembryonic Tissues)
- Primitive Erythrocytes Extraembryonic Blood Islands
-
Heart (Cardiovascular System)
- Cardiac Fibroblasts Myocardium
-
Fibroblasts
- Cardiac Fibroblasts Myocardium
-
Placenta (Extraembryonic Tissues)
- Primordial Germ Cells Allantois
-
Gonad
- Primordial Germ Cells Allantois
- Cartilage (Muscoskeletal System)
-
Colon (Gastrointestinal Tract)
-
Spinal Cord (Nervous System)
-
Limb (Muscoskeletal System)
This gene is overexpressed in Retina (10.2).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for DDAH1 Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for DDAH1
SOURCE GeneReport for Unigene cluster for DDAH1 Gene:
Hs.713411mRNA Expression by UniProt/SwissProt for DDAH1 Gene:
O94760-DDAH1_HUMAN
Tissue specificity:
Detected in brain, liver, kidney and pancreas, and at low levels in skeletal muscle.
Evidence on tissue expression from TISSUES for DDAH1 Gene
- Nervous system(4.9)
- Kidney(4.8)
- Liver(4.6)
- Intestine(4.5)
- Stomach(4.4)
- Heart(3)
- Muscle(2.8)
- Blood(2.7)
- Skin(2.5)
- Lung(2.4)
- Pancreas(2)
Primer products for research
-
OriGene qPCR primer pairs for DDAH1
-
OriGene qPCR primer pairs and template standards for DDAH1
Gene Expression Assays for research
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for DDAH1 Gene
Orthologs for DDAH1 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | DDAH1 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | DDAH1 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | DDAH1 30 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Ddah1 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Ddah1 30 |
|
||
| Platypus (Ornithorhynchus anatinus) |
Mammalia | DDAH1 31 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | DDAH1 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | DDAH1 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | DDAH1 31 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | ddah1 30 |
|
||
| African clawed frog (Xenopus laevis) |
Amphibia | ddah1-prov 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | DDAH1 31 |
|
OneToOne | |
| zgc:85829 30 |
|
||||
| Fruit Fly (Drosophila melanogaster) |
Insecta | CG1764 30 31 32 |
|
OneToMany | |
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP001644 30 |
|
- Species where no ortholog for DDAH1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Squirt (Ciona savignyi)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
- Worm (Caenorhabditis elegans)
Evolution for DDAH1 Gene
- ENSEMBL:
- Gene Tree for DDAH1 (if available)
- TreeFam:
- Gene Tree for DDAH1 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for DDAH1: view image
Paralogs for DDAH1 Gene
Variants for DDAH1 Gene
All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv120n106 | CNV | duplication | 24896259 |
| dgv31e214 | CNV | loss | 21293372 |
| dgv32e214 | CNV | gain | 21293372 |
| esv21828 | CNV | gain | 19812545 |
| esv2440186 | CNV | deletion | 19546169 |
| esv2647869 | CNV | gain | 19546169 |
| esv2663134 | CNV | deletion | 23128226 |
| esv2714296 | CNV | deletion | 23290073 |
| esv2941567 | CNV | duplication | 24192839 |
| esv34165 | CNV | loss | 18971310 |
| esv3577995 | CNV | loss | 25503493 |
| esv3577996 | CNV | loss | 25503493 |
| esv3586681 | CNV | gain | 21293372 |
| nsv1008877 | CNV | gain | 25217958 |
| nsv1075778 | CNV | duplication | 25765185 |
| nsv1128596 | CNV | duplication | 24896259 |
| nsv1142063 | CNV | tandem duplication | 24896259 |
| nsv1153631 | CNV | duplication | 26484159 |
| nsv1766 | CNV | insertion | 18451855 |
| nsv436030 | CNV | insertion | 17901297 |
| nsv441699 | CNV | loss | 18776908 |
| nsv821007 | CNV | duplication | 20802225 |
| nsv823398 | CNV | loss | 20364138 |
| nsv830459 | CNV | loss | 17160897 |
| nsv830470 | CNV | loss | 17160897 |
| nsv946038 | CNV | duplication | 23825009 |
| nsv950202 | CNV | duplication | 24416366 |
| nsv950203 | CNV | deletion | 24416366 |
Residual Variation Intolerance Score:
60.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.85;
34.70% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for DDAH1 Gene
SNP Genotyping and Copy Number Assays for research
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for DDAH1 Gene
Disorders for DDAH1 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| cardiovascular system disease |
|
|
| pulmonary hypertension |
|
|
| hypertension, essential |
|
|
Search DDAH1 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for DDAH1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- Atlas
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for DDAH1 Gene
Publications for DDAH1 Gene
- Circulating methylarginine levels and the decline in renal function in patients with chronic kidney disease are modulated by DDAH1 polymorphisms. (PMID: 20010544) Caplin B … Leiper JM (Kidney international 2010) 3 23 41
- A novel loss-of-function DDAH1 promoter polymorphism is associated with increased susceptibility to thrombosis stroke and coronary heart disease. (PMID: 20167924) Ding H … Wang DW (Circulation research 2010) 3 23 41
- Sequence variation in DDAH1 and DDAH2 genes is strongly and additively associated with serum ADMA concentrations in individuals with type 2 diabetes. (PMID: 20209122) Abhary S … Craig JE (PloS one 2010) 3 23 41
- Developing dual and specific inhibitors of dimethylarginine dimethylaminohydrolase-1 and nitric oxide synthase: toward a targeted polypharmacology to control nitric oxide. (PMID: 19663506) Wang Y … Fast W (Biochemistry 2009) 3 4 23
- Disruption of methylarginine metabolism impairs vascular homeostasis. (PMID: 17273169) Leiper J … Vallance P (Nature medicine 2007) 3 4 23
ExternalLinks
Products for DDAH1 Gene
- View all 2 R&D Systems DDAH1 (Dimethylarginine Dimethylaminohydrolase 1/DDAH1) Products
- View all R&D Systems DDAH1 (Dimethylarginine Dimethylaminohydrolase 1/DDAH1) Proteins and Enzymes
- View all R&D Systems DDAH1 (Dimethylarginine Dimethylaminohydrolase 1/DDAH1) Primary Antibodies
- Learn more about R&D Systems custom DDAH1 antibody, protein, and immunoassay development services
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for DDAH1
- Origene Custom Protein Services for DDAH1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DDAH1
- Browse OriGene Inhibitory RNA Products For DDAH1
- OriGene qPCR primer pairs for DDAH1
- OriGene qPCR primer pairs and template standards for DDAH1
- OriGene CRISPR knockouts for DDAH1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For DDAH1
- Sino Biological Human cDNA Clone for DDAH1
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Sino Biological Antibodies for DDAH1
- Browse Sino Biological Assays
- Browse Antibodies
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for DDAH1
- Novus Biologicals proteins and lysates for DDAH1
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for DDAH1
- Abcam proteins for DDAH1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for DDAH1
- Taconic Biosciences Mouse Models for DDAH1
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for DDAH1 (AFLGC-DDAH1)
- VectorBuilder Custom and pre-made DNA vectors for DDAH1 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for DDAH1 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for DDAH1 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for DDAH1 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for DDAH1
- antibodies-online: Show 17 available DDAH1 Antibodies ranked by validation data
- Compare Top DDAH1 Antibodies
- antibodies-online: Show 18 available DDAH1 Elisa Kits ranked by validation data
- Compare Top DDAH1 Elisa Kits
- Quality Products:
- antibodies-online: Show 13 available DDAH1 Proteins ranked by validation data
- Compare Top DDAH1 Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for DDAH1
- Search Santa Cruz Biotechnology (SCBT) for DDAH1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for DDAH1
- Custom Antibody ServicesProSci Antibodies for DDAH1
- Search for DDAH1 Proteins at ProSci
- Horizon Cell Lines for DDAH1
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for DDAH1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for DDAH1
- Search GeneCopoeia for miRNA 3'UTR Target clone products for DDAH1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for DDAH1
Sources for DDAH1 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM® (Updated: 05-Mar-2021)
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) MedlinePlus Genetics
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNAcentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Open Targets Platform
- (175) 5SRRNADB
- (176) snoDB
- (177) MirGeneDB