Aliases for DDAH1 Gene
Aliases for DDAH1 Gene
External Ids for DDAH1 Gene
- HGNC: 2715
- Entrez Gene: 23576
- Ensembl: ENSG00000153904
- OMIM: 604743
- UniProtKB: O94760
Previous GeneCards Identifiers for DDAH1 Gene
- GC01M086186
- GC01M084928
- GC01M085072
- GC01M085206
- GC01M085496
- GC01M085785
- GC01M083894
Summaries for DDAH1 Gene
-
This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. [provided by RefSeq, Jul 2008]
GeneCards Summary for DDAH1 Gene
DDAH1 (Dimethylarginine Dimethylaminohydrolase 1) is a Protein Coding gene. Diseases associated with DDAH1 include Diffuse Intrinsic Pontine Glioma and Encephalopathy, Ethylmalonic. Among its related pathways are Mesodermal Commitment Pathway and Metabolism. Gene Ontology (GO) annotations related to this gene include amino acid binding and dimethylargininase activity. An important paralog of this gene is DDAH2.
UniProtKB/Swiss-Prot for DDAH1 Gene
-
Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
Additional gene information for DDAH1 Gene
- Monarch Initiative
- Search for DDAH1 at DataMed
- Search for DDAH1 at HumanCyc
No data available for CIViC summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DDAH1 Gene
Genomics for DDAH1 Gene
GeneHancer (GH) Regulatory Elements for DDAH1 Gene
Promoters and enhancers for DDAH1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around DDAH1 on UCSC Golden Path with GeneCards custom track
- Top Transcription factor binding sites by QIAGEN in the DDAH1 gene promoter:
Regulatory Element Products
Genomic Locations for DDAH1 Gene
Genomic Locations for DDAH1 Gene
- chr1:85,318,481-85,578,363
- (GRCh38/hg38)
- Size:
- 259,883 bases
- Orientation:
- Minus strand
- chr1:85,784,164-86,044,046
- (GRCh37/hg19)
Genomic View for DDAH1 Gene
Genes around DDAH1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 1p22.3 by Ensembl
- 1p22.3 by Entrez Gene
- 1p22.3 by HGNC
DDAH1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for DDAH1 Gene
Proteins for DDAH1 Gene
-
Protein details for DDAH1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- O94760-DDAH1_HUMAN
- Recommended name:
- N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
- Protein Accession:
- O94760
- Q5HYC8
- Q86XK5
Protein attributes for DDAH1 Gene
- Size:
- 285 amino acids
- Molecular mass:
- 31122 Da
- Quaternary structure:
-
- Monomer.
Three dimensional structures from OCA and Proteopedia for DDAH1 Gene
Protein Expression for DDAH1 Gene
Selected DME Specific Peptides for DDAH1 Gene
- O94760:
-
- AANCIYLNIP
- DVLFTGREFFVGLSK
- DENATLDG
- AVSTVPV
- LHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDK
Post-translational modifications for DDAH1 Gene
No Post-translational modifications
Other Protein References for DDAH1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for DDAH1 (Dimethylarginine Dimethylaminohydrolase 1/DDAH1)
- Novus Biologicals Antibodies for DDAH1
-
Abcam antibodies for DDAH1
-
Cloud-Clone Corp. Antibodies for DDAH1
- Invitrogen Antibodies for DDAH1
- GeneTex DDAH1 antibody for DDAH1
-
Santa Cruz Biotechnology (SCBT) Antibodies for DDAH1
Protein Products
- R&D Systems Proteins and Enzymes for DDAH1 (Dimethylarginine Dimethylaminohydrolase 1/DDAH1)
-
OriGene Purified Proteins for DDAH1
- Search Origene for MassSpec and Protein Over-expression Lysates for DDAH1
- Origene Custom Protein Services for DDAH1
- ProSpec Recombinant Proteins for DDAH1
-
Cloud-Clone Corp. Proteins for DDAH1
- Search GeneTex for Proteins for DDAH1
-
Abcam proteins for DDAH1
Assay Products
-
Cloud-Clone Corp. Assay Kits for DDAH1
- antibodies-online: Search results for 14 available DDAH1 Elisa Kits ranked by validation data
- Compare Top DDAH1 Elisa Kits
-
Quality Products:
Domains & Families for DDAH1 Gene
Gene Families for DDAH1 Gene
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Plasma proteins
- Predicted intracellular proteins
Protein Domains for DDAH1 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for DDAH1 Gene
- GenScript: Design optimal peptide antigens:
-
- cDNA, FLJ92778, Homo sapiens dimethylarginine dimethylaminohydrolase 1 (DDAH1), mRNA (B1AKK2_HUMAN)
- cDNA FLJ54083, highly similar to NG,NG-dimethylarginine dimethylaminohydrolase 1 (EC 3.5.3.18) (B4DGT0_HUMAN)
- cDNA FLJ54119, highly similar to NG,NG-dimethylarginine dimethylaminohydrolase 1 (EC 3.5.3.18) (B4DYP1_HUMAN)
- Dimethylargininase-1 (DDAH1_HUMAN)
Graphical View of Domain Structure for InterPro Entry
O94760- Family:
-
- Belongs to the DDAH family.
Function for DDAH1 Gene
Molecular function for DDAH1 Gene
- GENATLAS Biochemistry:
- N-omega,N-omega dimethylarginine dimethylaminohydrolase 1
- UniProtKB/Swiss-Prot BiophysicochemicalProperties:
- Kinetic parameters: KM=69 uM for asymmetric dimethylarginine (ADMA) {ECO:0000269 PubMed:18171027, ECO:0000269 PubMed:19663506}; KM=54 uM for monomethyl-L-arginine (MMA) {ECO:0000269 PubMed:18171027, ECO:0000269 PubMed:19663506}; KM=3.1 uM for S-methyl-L-thiocitrulline {ECO:0000269 PubMed:18171027, ECO:0000269 PubMed:19663506}; Vmax=356 nmol/min/mg enzyme with ADMA {ECO:0000269 PubMed:18171027, ECO:0000269 PubMed:19663506}; Vmax=154 nmol/min/mg enzyme with NMA {ECO:0000269 PubMed:18171027, ECO:0000269 PubMed:19663506}; pH dependence: Optimum pH is 8.5. {ECO:0000269 PubMed:18171027, ECO:0000269 PubMed:19663506};
- UniProtKB/Swiss-Prot CatalyticActivity:
- N(omega),N(omega)-dimethyl-L-arginine + H(2)O = dimethylamine + L-citrulline.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Inhibited by zinc ions (By similarity). Enzyme purified in the absence of 1,10-phenanthroline contains on average 0.4 zinc atoms per subunit. Inhibited by 4-hydroxy-nonenal through the formation of a covalent adduct with His-173. Competitively inhibited by N(5)-iminopropyl-ornithine.
- UniProtKB/Swiss-Prot Function:
- Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
Enzyme Numbers (IUBMB) for DDAH1 Gene
Phenotypes From GWAS Catalog for DDAH1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0003824 | catalytic activity | TAS | 9874257 |
| GO:0016403 | dimethylargininase activity | TAS | -- |
| GO:0016597 | amino acid binding | IEA | -- |
| GO:0016787 | hydrolase activity | IEA | -- |
| GO:0046872 | metal ion binding | IEA | -- |
Phenotypes for DDAH1 Gene
- MGI mutant phenotypes for DDAH1:
- inferred from 6 alleles
- GenomeRNAi human phenotypes for DDAH1:
Animal Models for DDAH1 Gene
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for DDAH1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for DDAH1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for DDAH1 gene
- Search ViGene Biosciences for DDAH1
CRISPR Products
-
OriGene CRISPR knockouts for DDAH1
- genomics-online: gRNA clones - Search results for 106 available DDAH1 gene related products
- Overview of 106 available DDAH1 gene related products
- Applied Biological Materials CRISPR for DDAH1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for DDAH1
- GenScript: Design CRISPR guide RNA sequences for DDAH1
miRNA for DDAH1 Gene
- miRTarBase miRNAs that target DDAH1
-
- hsa-mir-210-3p (MIRT003179)
- hsa-mir-30b-5p (MIRT023452)
- hsa-mir-34a-5p (MIRT025359)
- hsa-mir-21-5p (MIRT030838)
- hsa-mir-18a-3p (MIRT040900)
- hsa-mir-221-3p (MIRT046866)
- hsa-mir-100-5p (MIRT048463)
- hsa-mir-92a-3p (MIRT049248)
- hsa-mir-18a-5p (MIRT050653)
- hsa-mir-1261 (MIRT346624)
- hsa-mir-5096 (MIRT478378)
- hsa-mir-377-3p (MIRT478379)
- hsa-mir-4775 (MIRT478380)
- hsa-mir-196a-3p (MIRT478381)
- hsa-mir-3128 (MIRT478382)
- hsa-mir-1228-3p (MIRT478383)
- hsa-mir-892b (MIRT478384)
- hsa-mir-193b-3p (MIRT478385)
- hsa-mir-193a-3p (MIRT478386)
- hsa-mir-590-3p (MIRT478387)
- hsa-mir-6509-5p (MIRT538141)
- hsa-mir-374b-3p (MIRT538142)
- hsa-mir-331-5p (MIRT538143)
- hsa-mir-4766-3p (MIRT538144)
- hsa-mir-140-3p (MIRT538145)
- hsa-mir-548p (MIRT538146)
- hsa-mir-411-5p (MIRT538147)
- hsa-mir-585-5p (MIRT538148)
- hsa-mir-891a-3p (MIRT538149)
- hsa-mir-376a-2-5p (MIRT538150)
- hsa-mir-5693 (MIRT538151)
- hsa-mir-936 (MIRT538152)
- hsa-mir-30e-5p (MIRT538153)
- hsa-mir-30c-5p (MIRT538154)
- hsa-mir-30d-5p (MIRT538155)
- hsa-mir-30a-5p (MIRT538156)
- hsa-mir-128-3p (MIRT538157)
- hsa-mir-3681-3p (MIRT538158)
- hsa-mir-216a-3p (MIRT538159)
- hsa-mir-29b-2-5p (MIRT558442)
- hsa-mir-376c-5p (MIRT558443)
- hsa-mir-376b-5p (MIRT558444)
- hsa-mir-509-3p (MIRT558445)
- hsa-mir-759 (MIRT558446)
- hsa-mir-6849-5p (MIRT558447)
- hsa-mir-4797-5p (MIRT558448)
- hsa-mir-3681-5p (MIRT558449)
- hsa-mir-3910 (MIRT558450)
- hsa-mir-548an (MIRT558451)
- hsa-mir-182-5p (MIRT558452)
- hsa-mir-183-5p (MIRT558453)
- hsa-mir-1271-5p (MIRT558454)
- hsa-mir-96-5p (MIRT558455)
- hsa-mir-5696 (MIRT568752)
- hsa-mir-4729 (MIRT568753)
- hsa-mir-579-3p (MIRT751499)
- hsa-mir-664b-3p (MIRT753610)
miRNA Products
- Search ViGene Biosciences for DDAH1
Inhibitory RNA Products
- Origene sirna, shrna, and RNAi products in human, mouse, rat for DDAH1
- Browse OriGene Inhibitory RNA Products For DDAH1
- genomics-online: shRNA clones - Search results for 106 available DDAH1 gene related products
- Overview of 106 available DDAH1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for DDAH1 gene
Clone Products
- Sino Biological Human cDNA Clone for DDAH1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for DDAH1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DDAH1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for DDAH1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for DDAH1
-
ViGene Biosciences adenoviral particle packaged cDNA for DDAH1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for DDAH1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for DDAH1 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for DDAH1 Gene
Localization for DDAH1 Gene
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| cytosol | 5 |
| mitochondrion | 3 |
| nucleus | 3 |
| plasma membrane | 2 |
| cytoskeleton | 1 |
- Cytosol (2)
- Nucleoli (2)
- Plasma membrane (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005739 | mitochondrion | IEA | -- |
| GO:0005829 | cytosol | TAS | -- |
| GO:0070062 | extracellular exosome | IDA,HDA | 19056867 |
No data available for Subcellular locations from UniProtKB/Swiss-Prot for DDAH1 Gene
Pathways & Interactions for DDAH1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | eNOS activation and regulation |
.01
|
|
| 2 | Mesodermal Commitment Pathway | ||
| 3 | Metabolism |
.37
|
|
Pathways by source for DDAH1 Gene
2 BioSystems pathways for DDAH1 Gene
4 Reactome pathways for DDAH1 Gene
Interacting Proteins for DDAH1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000052 | citrulline metabolic process | IDA | 19663506 |
| GO:0003073 | regulation of systemic arterial blood pressure | ISS | -- |
| GO:0006525 | arginine metabolic process | IEA | -- |
| GO:0006527 | arginine catabolic process | IDA,TAS | 24895913 |
| GO:0007263 | nitric oxide mediated signal transduction | TAS | 9874257 |
No data available for SIGNOR curated interactions for DDAH1 Gene
Transcripts for DDAH1 Gene
mRNA/cDNA for DDAH1 Gene
- (8) REFSEQ mRNAs :
- (14) Additional mRNA sequences :
- (249) Selected AceView cDNA sequences:
- (6) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for DDAH1 Gene
- Dimethylarginine dimethylaminohydrolase 1:
- Representative Sequences:
CRISPR Products
-
OriGene CRISPR knockouts for DDAH1
- genomics-online: gRNA clones - Search results for 106 available DDAH1 gene related products
- Overview of 106 available DDAH1 gene related products
- Applied Biological Materials CRISPR for DDAH1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for DDAH1
- GenScript: Design CRISPR guide RNA sequences for DDAH1
miRNA Products
- Search ViGene Biosciences for DDAH1
Inhibitory RNA Products
- Origene sirna, shrna, and RNAi products in human, mouse, rat for DDAH1
- Browse OriGene Inhibitory RNA Products For DDAH1
- genomics-online: shRNA clones - Search results for 106 available DDAH1 gene related products
- Overview of 106 available DDAH1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for DDAH1 gene
Clone Products
- Sino Biological Human cDNA Clone for DDAH1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for DDAH1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DDAH1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for DDAH1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Expression for DDAH1 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Brain (Nervous System)
- Neural Tube (Nervous System)
- Inner Cell Mass (Early Embryonic Tissues)
-
Blood (Cardiovascular System)
- Primitive Erythrocytes Extraembryonic Blood Islands
- Hematopoietic Stem Cells Hematopoietic Bone Marrow
- Tooth (Integumentary System)
-
Eye (Sensory Organs)
- GABAergic Amacrine Cells Inner Nuclear Layer
-
Neurons
- GABAergic Amacrine Cells Inner Nuclear Layer
-
Kidney (Urinary System)
- Presumptive Podocytes Podocyte Layer
-
Epithelial Cells
- Presumptive Podocytes Podocyte Layer
-
Extraembryonic Mesoderm (Extraembryonic Tissues)
- Primitive Erythrocytes Extraembryonic Blood Islands
-
Heart (Cardiovascular System)
- Cardiac Fibroblasts Myocardium
-
Fibroblasts
- Cardiac Fibroblasts Myocardium
-
Placenta (Extraembryonic Tissues)
- Primordial Germ Cells Allantois
-
Gonad
- Primordial Germ Cells Allantois
- Cartilage (Muscoskeletal System)
-
Colon (Gastrointestinal Tract)
-
Spinal Cord (Nervous System)
-
Limb (Muscoskeletal System)
This gene is overexpressed in Retina (10.2).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DDAH1 Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of DDAH1 Gene:
DDAH1SOURCE GeneReport for Unigene cluster for DDAH1 Gene:
Hs.713411mRNA Expression by UniProt/SwissProt for DDAH1 Gene:
O94760-DDAH1_HUMAN
Tissue specificity:
Detected in brain, liver, kidney and pancreas, and at low levels in skeletal muscle.
Evidence on tissue expression from TISSUES for DDAH1 Gene
- Nervous system(4.9)
- Kidney(4.7)
- Liver(4.5)
- Intestine(4.3)
- Stomach(4.3)
- Heart(2.6)
- Blood(2.2)
- Lung(2.2)
- Muscle(2.2)
Primer Products
-
OriGene qPCR primer pairs and template standards for DDAH1
-
OriGene qPCR primer pairs for DDAH1
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for DDAH1 Gene
Orthologs for DDAH1 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | DDAH1 33 34 |
|
||
| dog (Canis familiaris) |
Mammalia | DDAH1 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | DDAH1 33 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Ddah1 33 16 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Ddah1 33 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | DDAH1 34 |
|
OneToOne | |
| oppossum (Monodelphis domestica) |
Mammalia | DDAH1 34 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | DDAH1 33 34 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | DDAH1 34 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | ddah1 33 |
|
||
| African clawed frog (Xenopus laevis) |
Amphibia | ddah1-prov 33 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | DDAH1 34 |
|
OneToOne | |
| zgc:85829 33 |
|
||||
| fruit fly (Drosophila melanogaster) |
Insecta | CG1764 35 33 34 |
|
||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP001644 33 |
|
- Species where no ortholog for DDAH1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Paralogs for DDAH1 Gene
(1) SIMAP similar genes for DDAH1 Gene using alignment to 4 proteins:
Variants for DDAH1 Gene
| SNP ID | Clin | Chr 01 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1000001960 | -- | 85,333,101(-) | G/A | intron_variant | |
| rs1000033910 | -- | 85,350,792(-) | G/A | intron_variant | |
| rs1000043425 | -- | 85,382,291(-) | CCCC/CCC | genic_upstream_transcript_variant, intron_variant | |
| rs1000054995 | -- | 85,379,746(-) | C/A | 5_prime_UTR_variant, intron_variant | |
| rs1000057057 | -- | 85,551,394(-) | G/A | genic_upstream_transcript_variant, intron_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv120n106 | CNV | duplication | 24896259 |
| dgv31e214 | CNV | loss | 21293372 |
| dgv32e214 | CNV | gain | 21293372 |
| esv21828 | CNV | gain | 19812545 |
| esv2440186 | CNV | deletion | 19546169 |
| esv2647869 | CNV | gain | 19546169 |
| esv2663134 | CNV | deletion | 23128226 |
| esv2714296 | CNV | deletion | 23290073 |
| esv2941567 | CNV | duplication | 24192839 |
| esv34165 | CNV | loss | 18971310 |
| esv3577995 | CNV | loss | 25503493 |
| esv3577996 | CNV | loss | 25503493 |
| esv3586681 | CNV | gain | 21293372 |
| nsv1008877 | CNV | gain | 25217958 |
| nsv1075778 | CNV | duplication | 25765185 |
| nsv1128596 | CNV | duplication | 24896259 |
| nsv1142063 | CNV | tandem duplication | 24896259 |
| nsv1153631 | CNV | duplication | 26484159 |
| nsv1766 | CNV | insertion | 18451855 |
| nsv436030 | CNV | insertion | 17901297 |
| nsv441699 | CNV | loss | 18776908 |
| nsv821007 | CNV | duplication | 20802225 |
| nsv823398 | CNV | loss | 20364138 |
| nsv830459 | CNV | loss | 17160897 |
| nsv830470 | CNV | loss | 17160897 |
| nsv946038 | CNV | duplication | 23825009 |
| nsv950202 | CNV | duplication | 24416366 |
| nsv950203 | CNV | deletion | 24416366 |
Residual Variation Intolerance Score:
60.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.85;
34.70% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for DDAH1 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DDAH1 Gene
Disorders for DDAH1 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| diffuse intrinsic pontine glioma |
|
|
| encephalopathy, ethylmalonic |
|
|
Search DDAH1 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for DDAH1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for DDAH1 Gene
Publications for DDAH1 Gene
- Circulating methylarginine levels and the decline in renal function in patients with chronic kidney disease are modulated by DDAH1 polymorphisms. (PMID: 20010544) Caplin B … Leiper JM (Kidney international 2010) 3 22 44 58
- Sequence variation in DDAH1 and DDAH2 genes is strongly and additively associated with serum ADMA concentrations in individuals with type 2 diabetes. (PMID: 20209122) Abhary S … Craig JE (PloS one 2010) 3 22 44 58
- A novel loss-of-function DDAH1 promoter polymorphism is associated with increased susceptibility to thrombosis stroke and coronary heart disease. (PMID: 20167924) Ding H … Wang DW (Circulation research 2010) 3 22 44 58
- Developing dual and specific inhibitors of dimethylarginine dimethylaminohydrolase-1 and nitric oxide synthase: toward a targeted polypharmacology to control nitric oxide. (PMID: 19663506) Wang Y … Fast W (Biochemistry 2009) 3 4 22 58
- Disruption of methylarginine metabolism impairs vascular homeostasis. (PMID: 17273169) Leiper J … Vallance P (Nature medicine 2007) 3 4 22 58
Products for DDAH1 Gene
- R&D Systems Antibodies for DDAH1 (Dimethylarginine Dimethylaminohydrolase 1/DDAH1)
- R&D Systems Proteins and Enzymes for DDAH1 (Dimethylarginine Dimethylaminohydrolase 1/DDAH1)
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for DDAH1
- Search Origene for MassSpec and Protein Over-expression Lysates for DDAH1
- Origene Custom Protein Services for DDAH1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DDAH1
- Browse OriGene Inhibitory RNA Products For DDAH1
- OriGene qPCR primer pairs and template standards for DDAH1
- OriGene qPCR primer pairs for DDAH1
- OriGene CRISPR knockouts for DDAH1
- OriGene ORF clones in human for DDAH1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For DDAH1
- GenScript: Next-day shipping of latest version cDNA ORF clones for DDAH1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for DDAH1
- GenScript Custom Assay Services for DDAH1
- GenScript Custom overexpressing Cell Line Services for DDAH1
- GenScript: Design CRISPR guide RNA sequences for DDAH1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for DDAH1
- Sino Biological Human cDNA Clone for DDAH1
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for DDAH1
- Novus Biologicals lysates and proteins for DDAH1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for DDAH1
- Abcam proteins for DDAH1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for DDAH1
- Cloud-Clone Corp. Antibodies for DDAH1
- Cloud-Clone Corp. Proteins for DDAH1
- Cloud-Clone Corp. Assay Kits for DDAH1
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for DDAH1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for DDAH1
- VectorBuilder custom plasmid, inducible vectors for DDAH1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DDAH1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 77 available DDAH1 Antibodies ranked by validation data
- Compare Top DDAH1 Antibodies
- antibodies-online: Search results for 14 available DDAH1 Elisa Kits ranked by validation data
- Compare Top DDAH1 Elisa Kits
- Quality Products:
- antibodies-online: Search results for 15 available DDAH1 Proteins ranked by validation data
- Compare Top DDAH1 Proteins
- GeneTex DDAH1 antibody for DDAH1
- Search GeneTex for Proteins for DDAH1
- ViGene Biosciences adenoviral particle packaged cDNA for DDAH1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for DDAH1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for DDAH1 gene
- Search ViGene Biosciences for DDAH1
- Santa Cruz Biotechnology (SCBT) Antibodies for DDAH1
- Search Santa Cruz Biotechnology (SCBT) for DDAH1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for DDAH1
- Horizon Cell Lines for DDAH1
- genomics-online: cdna clones - Search results for 106 available DDAH1 gene related products
- Overview of 106 available DDAH1 gene related products
- orf clones - Search results for 106 available DDAH1 gene related products
- Overview of 106 available DDAH1 gene related products
- genomics-online: gRNA clones - Search results for 106 available DDAH1 gene related products
- Overview of 106 available DDAH1 gene related products
- genomics-online: primer clones - Search results for 106 available DDAH1 gene related products
- Overview of 106 available DDAH1 gene related products
- genomics-online: shRNA clones - Search results for 106 available DDAH1 gene related products
- Overview of 106 available DDAH1 gene related products
Sources for DDAH1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew